Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00362
Gene name
Locationscaffold_01:1575120..1575552
Strand-
Gene length (bp)432
Transcript length (bp)432
Coding sequence length (bp)432
Protein length (aa) 144

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00011 HSP20 Hsp20/alpha crystallin family 3.8E-07 29 142

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5449 0.3338 0.5706 0.034 0.1778 0.0558 0.479 0.2665 0.0509 0.0432

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 8.32 1.14 15.50
Alive In ants, during behavior modification 25.47 7.03 43.92
Dead In ants, recently dead 19.76 5.12 34.41

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.002287 yes
Alive Dead 0.384811 no
Dead Fungus 0.014273 yes

Orthologs

Orthofinder run ID4
Orthogroup6836
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4318
Ophiocordyceps camponoti-floridani Ophcf2|00362 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4016
Ophiocordyceps kimflemingae Ophio5|2905

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00362
MMRNILNNPFFQPPRDDNDASSFTPPIDIFSDPSAFTIHVALPGAHKSDIGLDWDPQRSSLRIAGVVHRPGDEAF
VATLVSSERAVGVFDRHVPLPPRDAGAADADVVVDDAGITARMEHGILIVVVPKVAKEKVEVRRVVID*
Coding >Ophcf2|00362
ATGATGCGCAACATCCTCAACAACCCCTTCTTCCAACCCCCCCGCGACGACAACGACGCCTCATCCTTCACTCCG
CCCATCGACATCTTCAGCGATCCCTCGGCCTTTACCATTCACGTCGCCCTCCCCGGCGCCCACAAGTCCGACATC
GGCCTCGACTGGGATCCGCAGCGGTCTAGCCTGCGCATCGCTGGCGTCGTCCACCGGCCCGGAGACGAGGCCTTC
GTCGCTACCCTCGTGTCTTCTGAGCGTGCTGTCGGCGTCTTTGATCGTCATGTGCCGTTGCCGCCGAGGGATGCT
GGGGCTGCCGACGCGGATGTTGTTGTTGACGATGCTGGCATTACGGCTAGGATGGAGCATGGCATCTTGATTGTC
GTTGTGCCCAAGGTTGCCAAGGAGAAGGTGGAGGTTCGACGGGTCGTCATCGATTAA
Transcript >Ophcf2|00362
ATGATGCGCAACATCCTCAACAACCCCTTCTTCCAACCCCCCCGCGACGACAACGACGCCTCATCCTTCACTCCG
CCCATCGACATCTTCAGCGATCCCTCGGCCTTTACCATTCACGTCGCCCTCCCCGGCGCCCACAAGTCCGACATC
GGCCTCGACTGGGATCCGCAGCGGTCTAGCCTGCGCATCGCTGGCGTCGTCCACCGGCCCGGAGACGAGGCCTTC
GTCGCTACCCTCGTGTCTTCTGAGCGTGCTGTCGGCGTCTTTGATCGTCATGTGCCGTTGCCGCCGAGGGATGCT
GGGGCTGCCGACGCGGATGTTGTTGTTGACGATGCTGGCATTACGGCTAGGATGGAGCATGGCATCTTGATTGTC
GTTGTGCCCAAGGTTGCCAAGGAGAAGGTGGAGGTTCGACGGGTCGTCATCGATTAA
Gene >Ophcf2|00362
ATGATGCGCAACATCCTCAACAACCCCTTCTTCCAACCCCCCCGCGACGACAACGACGCCTCATCCTTCACTCCG
CCCATCGACATCTTCAGCGATCCCTCGGCCTTTACCATTCACGTCGCCCTCCCCGGCGCCCACAAGTCCGACATC
GGCCTCGACTGGGATCCGCAGCGGTCTAGCCTGCGCATCGCTGGCGTCGTCCACCGGCCCGGAGACGAGGCCTTC
GTCGCTACCCTCGTGTCTTCTGAGCGTGCTGTCGGCGTCTTTGATCGTCATGTGCCGTTGCCGCCGAGGGATGCT
GGGGCTGCCGACGCGGATGTTGTTGTTGACGATGCTGGCATTACGGCTAGGATGGAGCATGGCATCTTGATTGTC
GTTGTGCCCAAGGTTGCCAAGGAGAAGGTGGAGGTTCGACGGGTCGTCATCGATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail