Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00358
Gene name
Locationscaffold_01:1558757..1559680
Strand-
Gene length (bp)923
Transcript length (bp)864
Coding sequence length (bp)864
Protein length (aa) 288

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06912 DUF1275 Protein of unknown function (DUF1275) 6.1E-43 65 269

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 111 130 19
2 143 162 19
3 172 191 19
4 231 248 17
5 252 274 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 49.41 25.44 73.38
Alive In ants, during behavior modification 41.00 20.21 61.79
Dead In ants, recently dead 38.87 19.10 58.65

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.428110 no
Alive Dead 0.818939 no
Dead Fungus 0.293065 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00358
MFCRLPLQAANHAPEKNSRAPESVSQEISSQTSAGSFWPLAPERSRLVGHFSDDVRSSLFAEAQLVLLTFCTGIQ
DVTTFLDYHCFASNQTGNTVFLCIALIISQIEGDTFVTANVGMSLGVFLAAGWLTGQLSHVIGGRKRWWLVSCNL
LQTALVFTVAGIQYRYGSSDRGPVALGVIALLAFAAGGQVVQSRSLRITEISTAMATAAWVDLVMDGKLFVLHNR
PRNRRLAFLIALAVGSLVGAAVYRQLGSAAAIAISAAGKLLVTILFLFSPAEIRRRGGAAEV*
Coding >Ophcf2|00358
ATGTTCTGTCGCCTGCCTCTTCAGGCGGCAAATCACGCCCCAGAGAAGAACTCGAGGGCTCCCGAGTCCGTATCC
CAGGAGATCTCGTCCCAAACCAGCGCCGGCTCCTTCTGGCCCCTTGCGCCGGAAAGGAGCCGGCTCGTCGGTCAC
TTTTCCGACGACGTCCGCTCCTCGCTCTTCGCCGAGGCACAGCTTGTGCTGCTGACCTTTTGCACGGGAATTCAA
GACGTCACCACCTTTCTAGACTATCACTGCTTCGCCTCGAACCAGACCGGCAACACCGTCTTCCTCTGCATCGCC
CTCATCATCTCCCAGATCGAGGGCGACACCTTCGTGACGGCCAACGTCGGCATGTCCCTCGGCGTCTTCCTGGCC
GCGGGATGGTTGACGGGCCAACTGAGCCACGTCATCGGTGGACGGAAGCGTTGGTGGCTGGTCTCGTGCAACCTC
CTTCAGACTGCCCTGGTCTTCACCGTAGCCGGGATCCAGTACCGCTACGGCAGCTCCGATCGCGGACCCGTTGCC
CTCGGCGTCATAGCCCTGTTGGCCTTTGCCGCGGGCGGGCAGGTGGTTCAGTCTCGCAGCCTGCGCATCACCGAG
ATCAGCACCGCCATGGCGACGGCGGCTTGGGTTGACCTCGTCATGGACGGAAAGCTGTTTGTGCTGCACAACCGA
CCGAGGAATCGTCGCCTCGCCTTCCTGATCGCCCTGGCCGTCGGATCTCTGGTTGGCGCCGCCGTCTACCGCCAG
CTGGGCTCGGCGGCCGCCATTGCGATATCCGCGGCCGGAAAACTGCTCGTCACGATCCTCTTCCTGTTCTCGCCC
GCTGAGATCCGGCGACGGGGGGGGGCAGCAGAGGTGTAA
Transcript >Ophcf2|00358
ATGTTCTGTCGCCTGCCTCTTCAGGCGGCAAATCACGCCCCAGAGAAGAACTCGAGGGCTCCCGAGTCCGTATCC
CAGGAGATCTCGTCCCAAACCAGCGCCGGCTCCTTCTGGCCCCTTGCGCCGGAAAGGAGCCGGCTCGTCGGTCAC
TTTTCCGACGACGTCCGCTCCTCGCTCTTCGCCGAGGCACAGCTTGTGCTGCTGACCTTTTGCACGGGAATTCAA
GACGTCACCACCTTTCTAGACTATCACTGCTTCGCCTCGAACCAGACCGGCAACACCGTCTTCCTCTGCATCGCC
CTCATCATCTCCCAGATCGAGGGCGACACCTTCGTGACGGCCAACGTCGGCATGTCCCTCGGCGTCTTCCTGGCC
GCGGGATGGTTGACGGGCCAACTGAGCCACGTCATCGGTGGACGGAAGCGTTGGTGGCTGGTCTCGTGCAACCTC
CTTCAGACTGCCCTGGTCTTCACCGTAGCCGGGATCCAGTACCGCTACGGCAGCTCCGATCGCGGACCCGTTGCC
CTCGGCGTCATAGCCCTGTTGGCCTTTGCCGCGGGCGGGCAGGTGGTTCAGTCTCGCAGCCTGCGCATCACCGAG
ATCAGCACCGCCATGGCGACGGCGGCTTGGGTTGACCTCGTCATGGACGGAAAGCTGTTTGTGCTGCACAACCGA
CCGAGGAATCGTCGCCTCGCCTTCCTGATCGCCCTGGCCGTCGGATCTCTGGTTGGCGCCGCCGTCTACCGCCAG
CTGGGCTCGGCGGCCGCCATTGCGATATCCGCGGCCGGAAAACTGCTCGTCACGATCCTCTTCCTGTTCTCGCCC
GCTGAGATCCGGCGACGGGGGGGGGCAGCAGAGGTGTAA
Gene >Ophcf2|00358
ATGTTCTGTCGCCTGCCTCTTCAGGCGGCAAATCACGCCCCAGAGAAGAACTCGAGGGCTCCCGAGTCCGTATCC
CAGGAGATCTCGTCCCAAACCAGCGCCGGCTCCTTCTGGCCCCTTGCGCCGGAAAGGAGCCGGCTCGTCGGTCAC
TTTTCCGACGACGTCCGCTCCTCGCTCTTCGCCGAGGCACAGCTTGTGCTGCTGACCTTTTGCACGGGAATTCAA
GGTGAAGAGGAGAGCTAGGCTTCGTGATAGTATGCGGAAGCTGACGCGGCCCAATGCCAGACGTCACCACCTTTC
TAGACTATCACTGCTTCGCCTCGAACCAGACCGGCAACACCGTCTTCCTCTGCATCGCCCTCATCATCTCCCAGA
TCGAGGGCGACACCTTCGTGACGGCCAACGTCGGCATGTCCCTCGGCGTCTTCCTGGCCGCGGGATGGTTGACGG
GCCAACTGAGCCACGTCATCGGTGGACGGAAGCGTTGGTGGCTGGTCTCGTGCAACCTCCTTCAGACTGCCCTGG
TCTTCACCGTAGCCGGGATCCAGTACCGCTACGGCAGCTCCGATCGCGGACCCGTTGCCCTCGGCGTCATAGCCC
TGTTGGCCTTTGCCGCGGGCGGGCAGGTGGTTCAGTCTCGCAGCCTGCGCATCACCGAGATCAGCACCGCCATGG
CGACGGCGGCTTGGGTTGACCTCGTCATGGACGGAAAGCTGTTTGTGCTGCACAACCGACCGAGGAATCGTCGCC
TCGCCTTCCTGATCGCCCTGGCCGTCGGATCTCTGGTTGGCGCCGCCGTCTACCGCCAGCTGGGCTCGGCGGCCG
CCATTGCGATATCCGCGGCCGGAAAACTGCTCGTCACGATCCTCTTCCTGTTCTCGCCCGCTGAGATCCGGCGAC
GGGGGGGGGCAGCAGAGGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail