Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00355
Gene name
Locationscaffold_01:1551898..1552652
Strand-
Gene length (bp)754
Transcript length (bp)696
Coding sequence length (bp)696
Protein length (aa) 232

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05572 Peptidase_M43 Pregnancy-associated plasma protein-A 2.1E-08 163 229

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Extracellular 0.5378 0.3092 0.718 0.1034 0.41 0.4262 0.0941 0.0778 0.1333 0.0065

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4583
Ophiocordyceps australis 1348a (Ghana) OphauG2|3462
Ophiocordyceps australis 1348a (Ghana) OphauG2|3271
Ophiocordyceps australis 1348a (Ghana) OphauG2|1070
Ophiocordyceps australis map64 (Brazil) OphauB2|1858
Ophiocordyceps australis map64 (Brazil) OphauB2|7807
Ophiocordyceps australis map64 (Brazil) OphauB2|6069
Ophiocordyceps australis map64 (Brazil) OphauB2|6047
Ophiocordyceps camponoti-floridani Ophcf2|00341
Ophiocordyceps camponoti-floridani Ophcf2|00355 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03551
Ophiocordyceps camponoti-floridani Ophcf2|05155
Ophiocordyceps camponoti-floridani Ophcf2|05704
Ophiocordyceps camponoti-floridani Ophcf2|07227
Ophiocordyceps camponoti-floridani Ophcf2|00720
Ophiocordyceps camponoti-rufipedis Ophun1|1354
Ophiocordyceps camponoti-rufipedis Ophun1|1841
Ophiocordyceps camponoti-rufipedis Ophun1|2519
Ophiocordyceps camponoti-rufipedis Ophun1|2683
Ophiocordyceps camponoti-rufipedis Ophun1|3615
Ophiocordyceps camponoti-rufipedis Ophun1|5398
Ophiocordyceps camponoti-rufipedis Ophun1|7222
Ophiocordyceps kimflemingae Ophio5|7575
Ophiocordyceps kimflemingae Ophio5|1310
Ophiocordyceps kimflemingae Ophio5|3287
Ophiocordyceps kimflemingae Ophio5|3438
Ophiocordyceps kimflemingae Ophio5|4474
Ophiocordyceps kimflemingae Ophio5|5248
Ophiocordyceps kimflemingae Ophio5|6057
Ophiocordyceps kimflemingae Ophio5|6793
Ophiocordyceps kimflemingae Ophio5|7576
Ophiocordyceps kimflemingae Ophio5|8134
Ophiocordyceps kimflemingae Ophio5|8139
Ophiocordyceps subramaniannii Hirsu2|2383
Ophiocordyceps subramaniannii Hirsu2|2879
Ophiocordyceps subramaniannii Hirsu2|2880
Ophiocordyceps subramaniannii Hirsu2|5803
Ophiocordyceps subramaniannii Hirsu2|8099
Ophiocordyceps subramaniannii Hirsu2|9120
Ophiocordyceps subramaniannii Hirsu2|6554
Ophiocordyceps subramaniannii Hirsu2|716
Ophiocordyceps subramaniannii Hirsu2|6536
Ophiocordyceps subramaniannii Hirsu2|1174

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00355
MEPILVETYIHVLAGDQKSLDRVELNMLTGQVDTLKRDFWPSRISFTLMDIESEVEPEFATLDSTAAVRAMQKRY
NKGDEATLNIYIVNEINVPINHLDCEAPVNSSTAGITEMPEGGLLGVSSFPWNVLDSSASDSWSNAVIVKADTLP
GYLLQLAYAHPRLGKTATHEIGHWFGLFHTFDEDCDTPFGDLVADTPESAGPTKGCPMSRDSHPDKPGLDPIHNY
MDYSSE*
Coding >Ophcf2|00355
ATGGAGCCCATCTTGGTTGAGACGTACATCCACGTCCTCGCCGGCGATCAAAAGTCGCTGGACCGTGTCGAGCTC
AACATGCTGACGGGCCAAGTCGACACCTTGAAACGAGACTTTTGGCCGTCACGTATCTCCTTTACCTTGATGGAT
ATCGAGTCCGAAGTCGAGCCCGAGTTCGCCACGCTCGACAGCACCGCCGCGGTCCGAGCCATGCAAAAGAGGTAT
AACAAGGGCGACGAGGCGACGCTCAACATCTACATCGTCAACGAGATCAACGTCCCAATCAACCACCTAGACTGC
GAGGCCCCCGTCAACAGCTCCACGGCCGGCATCACGGAGATGCCCGAAGGTGGCTTGCTGGGCGTGTCGAGCTTC
CCGTGGAACGTCCTCGACAGCTCGGCATCCGATTCGTGGTCCAATGCCGTCATTGTCAAAGCCGATACTCTCCCC
GGCTATCTTCTCCAGCTCGCCTATGCTCACCCTCGTCTGGGAAAGACGGCAACGCACGAAATCGGCCACTGGTTC
GGCTTATTCCACACCTTTGACGAGGACTGCGATACCCCCTTTGGCGACTTGGTCGCTGACACGCCCGAGTCGGCC
GGTCCCACCAAAGGATGTCCGATGAGCCGGGATTCTCACCCAGACAAACCTGGTCTCGATCCCATCCATAACTAC
ATGGACTATTCCTCCGAGTAA
Transcript >Ophcf2|00355
ATGGAGCCCATCTTGGTTGAGACGTACATCCACGTCCTCGCCGGCGATCAAAAGTCGCTGGACCGTGTCGAGCTC
AACATGCTGACGGGCCAAGTCGACACCTTGAAACGAGACTTTTGGCCGTCACGTATCTCCTTTACCTTGATGGAT
ATCGAGTCCGAAGTCGAGCCCGAGTTCGCCACGCTCGACAGCACCGCCGCGGTCCGAGCCATGCAAAAGAGGTAT
AACAAGGGCGACGAGGCGACGCTCAACATCTACATCGTCAACGAGATCAACGTCCCAATCAACCACCTAGACTGC
GAGGCCCCCGTCAACAGCTCCACGGCCGGCATCACGGAGATGCCCGAAGGTGGCTTGCTGGGCGTGTCGAGCTTC
CCGTGGAACGTCCTCGACAGCTCGGCATCCGATTCGTGGTCCAATGCCGTCATTGTCAAAGCCGATACTCTCCCC
GGCTATCTTCTCCAGCTCGCCTATGCTCACCCTCGTCTGGGAAAGACGGCAACGCACGAAATCGGCCACTGGTTC
GGCTTATTCCACACCTTTGACGAGGACTGCGATACCCCCTTTGGCGACTTGGTCGCTGACACGCCCGAGTCGGCC
GGTCCCACCAAAGGATGTCCGATGAGCCGGGATTCTCACCCAGACAAACCTGGTCTCGATCCCATCCATAACTAC
ATGGACTATTCCTCCGAGTAA
Gene >Ophcf2|00355
ATGGAGCCCATCTTGGTTGAGACGTACATCCACGTCCTCGCCGGCGATCAAAAGTCGCTGGACCGTGTCGAGGTG
ACTGACTTCTGCCTCACGTGAGACGAGGCGTCCTCTGTTATTGACGCACCCAGAGCTCAACATGCTGACGGGCCA
AGTCGACACCTTGAAACGAGACTTTTGGCCGTCACGTATCTCCTTTACCTTGATGGATATCGAGTCCGAAGTCGA
GCCCGAGTTCGCCACGCTCGACAGCACCGCCGCGGTCCGAGCCATGCAAAAGAGGTATAACAAGGGCGACGAGGC
GACGCTCAACATCTACATCGTCAACGAGATCAACGTCCCAATCAACCACCTAGACTGCGAGGCCCCCGTCAACAG
CTCCACGGCCGGCATCACGGAGATGCCCGAAGGTGGCTTGCTGGGCGTGTCGAGCTTCCCGTGGAACGTCCTCGA
CAGCTCGGCATCCGATTCGTGGTCCAATGCCGTCATTGTCAAAGCCGATACTCTCCCCGGCTATCTTCTCCAGCT
CGCCTATGCTCACCCTCGTCTGGGAAAGACGGCAACGCACGAAATCGGCCACTGGTTCGGCTTATTCCACACCTT
TGACGAGGACTGCGATACCCCCTTTGGCGACTTGGTCGCTGACACGCCCGAGTCGGCCGGTCCCACCAAAGGATG
TCCGATGAGCCGGGATTCTCACCCAGACAAACCTGGTCTCGATCCCATCCATAACTACATGGACTATTCCTCCGA
GTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail