Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00344
Gene name
Locationscaffold_01:1529030..1531357
Strand-
Gene length (bp)2327
Transcript length (bp)2037
Coding sequence length (bp)2037
Protein length (aa) 679

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 1.7E-75 50 416
PF07976 Phe_hydrox_dim Phenol hydroxylase, C-terminal dimerisation domain 1.6E-28 442 611
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 1.3E-06 52 231

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0071949 FAD binding Yes
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0003824 catalytic activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.7944 0.2996 0.0693 0.1047 0.1231 0.0231 0.2496 0.2627 0.4827 0.0813

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4340
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1592
Ophiocordyceps australis map64 (Brazil) OphauB2|2123
Ophiocordyceps camponoti-floridani Ophcf2|00344 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7231
Ophiocordyceps kimflemingae Ophio5|7969
Ophiocordyceps subramaniannii Hirsu2|8916

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00344
MAPGILHGSPSLDSPIVDVEHQLAPVDEAKEMDAVADLTMLRSFPEPPVECQVCVVGAGPAGLMLAATLGRCGIR
VEVIDDRADQTPVGRADGLQPKTIETLRQLRIADTLLQRGVRVFDISFWRSTATEPLHRLGREVHYPPVIDVLDP
YILLVHQGIVESLFIDDMRKRGREVRRNTAFESYDHVAGKSGQIQVNCRTNVNHDKRTILAQYLVGCDGAHSKVR
KSMPDVEAVGMSQAAIWGVLDGELITDFPDIWSKTLVYSEEHGSILIIPRERNMTRLIIPRERNMTRFYIELKAC
ATTDRRQLGQSFVMQQARKIMAPFSVDWRYIEWFGRYQVGQRVASRFSDAKTRVFLSGDASHTHSPKAAQGMNTS
MHDSWNLGWKLNLAVRGLAKPELLQSYDEERRKIALDLVNFDYEHANQIAGGDAVALAKNFKANVRFISGIGAEY
DGSAINHIDGSPSDASSSTVGGDARPGCLLPPAKVTRYIDSNPVDIQLDIPMLGQFRVFLLMWDVQQAAPFLATF
CRAVAGDGSLMSQLSAAASASYAAQPRLGSPEDVYIRPERYTAVSHLFTFALITTMAKAEMEISDLPALLQDSRW
TLYLDDVPEKDTRGQLCTDKWLGSLEPGEVAVVNVRPDGYVGSVGRWDSSVDDAGEQAARWLDAYYGGFMRVPAA
AET*
Coding >Ophcf2|00344
ATGGCGCCTGGCATCCTCCATGGAAGCCCGTCGCTCGATAGCCCCATTGTCGACGTCGAGCACCAGCTGGCCCCC
GTCGACGAGGCCAAGGAGATGGACGCCGTCGCCGACCTCACCATGCTACGGAGCTTCCCCGAGCCGCCCGTCGAG
TGTCAGGTCTGCGTCGTCGGAGCCGGTCCAGCCGGTCTCATGCTGGCCGCCACCCTCGGCCGCTGCGGTATCCGC
GTCGAGGTCATTGACGACCGAGCCGATCAGACGCCAGTCGGAAGGGCCGACGGCCTGCAGCCCAAGACCATCGAG
ACCCTGAGGCAGCTTCGCATCGCCGACACACTGCTCCAGCGCGGCGTCCGCGTCTTCGACATTTCCTTCTGGCGC
AGCACCGCCACTGAGCCGCTTCACCGCCTCGGCCGCGAAGTTCACTATCCGCCTGTCATTGACGTCTTGGACCCC
TACATTCTGTTGGTTCACCAGGGCATCGTCGAGAGCCTCTTCATCGACGACATGCGGAAGCGCGGCAGGGAGGTC
CGTCGGAATACCGCCTTTGAATCGTACGACCACGTCGCCGGCAAGTCGGGGCAGATTCAGGTCAACTGCCGCACC
AACGTGAACCACGATAAGCGGACCATTCTCGCGCAGTACCTAGTTGGCTGCGACGGTGCCCACTCCAAGGTGCGC
AAGAGCATGCCCGACGTCGAGGCCGTGGGCATGTCCCAGGCCGCCATCTGGGGTGTTCTCGACGGCGAGCTCATC
ACCGACTTCCCCGACATCTGGTCCAAGACGCTCGTCTACTCGGAAGAGCACGGGTCCATCCTCATCATCCCGCGA
GAGCGCAACATGACGCGCCTCATCATCCCGCGAGAGCGCAACATGACGCGCTTCTACATCGAGCTCAAGGCGTGC
GCCACGACGGACCGCCGGCAGCTCGGCCAGAGCTTTGTCATGCAACAGGCGAGGAAAATAATGGCGCCTTTCTCC
GTCGACTGGCGGTATATCGAGTGGTTCGGCCGGTATCAGGTCGGGCAGCGCGTAGCGAGCCGCTTCTCCGACGCA
AAGACGCGCGTCTTCTTGTCAGGCGATGCCAGTCACACGCACTCGCCCAAGGCGGCGCAGGGCATGAACACGTCG
ATGCACGACTCTTGGAACCTCGGCTGGAAGCTCAACCTGGCCGTCCGCGGTCTGGCCAAACCCGAGCTTCTGCAG
AGCTACGACGAGGAGAGGCGCAAGATCGCCCTCGACCTCGTCAACTTCGACTACGAGCACGCCAACCAGATCGCA
GGCGGAGACGCCGTCGCCCTGGCAAAGAACTTCAAGGCAAACGTCCGTTTCATCTCGGGCATCGGCGCCGAGTAC
GACGGAAGCGCCATCAACCACATCGACGGTTCCCCCTCCGACGCCTCTTCGTCCACCGTCGGCGGCGACGCCCGT
CCGGGATGCTTACTGCCGCCGGCCAAGGTGACGCGTTACATCGACTCCAACCCGGTCGACATCCAGCTCGACATT
CCCATGCTAGGCCAGTTCCGCGTCTTCCTCCTCATGTGGGACGTCCAGCAGGCGGCTCCCTTCCTCGCCACCTTT
TGCCGCGCCGTCGCAGGTGACGGCTCCCTGATGAGCCAGCTATCGGCCGCCGCCAGCGCCTCGTACGCTGCTCAG
CCCCGTCTGGGTTCGCCCGAAGACGTCTACATCCGCCCGGAGCGGTACACCGCCGTCAGCCACCTCTTTACCTTT
GCCCTCATCACAACAATGGCCAAGGCAGAGATGGAAATCTCCGACCTCCCCGCCCTCCTCCAAGACAGCCGCTGG
ACCCTCTACCTCGACGACGTACCCGAAAAGGACACGCGCGGCCAGCTCTGCACCGACAAGTGGCTCGGCAGCCTG
GAACCGGGCGAGGTGGCCGTCGTCAACGTCCGTCCGGACGGCTACGTCGGCTCCGTCGGCCGCTGGGACTCGAGC
GTCGACGATGCTGGCGAGCAGGCTGCTCGTTGGCTCGATGCTTACTACGGAGGCTTCATGCGAGTTCCCGCCGCG
GCCGAGACGTGA
Transcript >Ophcf2|00344
ATGGCGCCTGGCATCCTCCATGGAAGCCCGTCGCTCGATAGCCCCATTGTCGACGTCGAGCACCAGCTGGCCCCC
GTCGACGAGGCCAAGGAGATGGACGCCGTCGCCGACCTCACCATGCTACGGAGCTTCCCCGAGCCGCCCGTCGAG
TGTCAGGTCTGCGTCGTCGGAGCCGGTCCAGCCGGTCTCATGCTGGCCGCCACCCTCGGCCGCTGCGGTATCCGC
GTCGAGGTCATTGACGACCGAGCCGATCAGACGCCAGTCGGAAGGGCCGACGGCCTGCAGCCCAAGACCATCGAG
ACCCTGAGGCAGCTTCGCATCGCCGACACACTGCTCCAGCGCGGCGTCCGCGTCTTCGACATTTCCTTCTGGCGC
AGCACCGCCACTGAGCCGCTTCACCGCCTCGGCCGCGAAGTTCACTATCCGCCTGTCATTGACGTCTTGGACCCC
TACATTCTGTTGGTTCACCAGGGCATCGTCGAGAGCCTCTTCATCGACGACATGCGGAAGCGCGGCAGGGAGGTC
CGTCGGAATACCGCCTTTGAATCGTACGACCACGTCGCCGGCAAGTCGGGGCAGATTCAGGTCAACTGCCGCACC
AACGTGAACCACGATAAGCGGACCATTCTCGCGCAGTACCTAGTTGGCTGCGACGGTGCCCACTCCAAGGTGCGC
AAGAGCATGCCCGACGTCGAGGCCGTGGGCATGTCCCAGGCCGCCATCTGGGGTGTTCTCGACGGCGAGCTCATC
ACCGACTTCCCCGACATCTGGTCCAAGACGCTCGTCTACTCGGAAGAGCACGGGTCCATCCTCATCATCCCGCGA
GAGCGCAACATGACGCGCCTCATCATCCCGCGAGAGCGCAACATGACGCGCTTCTACATCGAGCTCAAGGCGTGC
GCCACGACGGACCGCCGGCAGCTCGGCCAGAGCTTTGTCATGCAACAGGCGAGGAAAATAATGGCGCCTTTCTCC
GTCGACTGGCGGTATATCGAGTGGTTCGGCCGGTATCAGGTCGGGCAGCGCGTAGCGAGCCGCTTCTCCGACGCA
AAGACGCGCGTCTTCTTGTCAGGCGATGCCAGTCACACGCACTCGCCCAAGGCGGCGCAGGGCATGAACACGTCG
ATGCACGACTCTTGGAACCTCGGCTGGAAGCTCAACCTGGCCGTCCGCGGTCTGGCCAAACCCGAGCTTCTGCAG
AGCTACGACGAGGAGAGGCGCAAGATCGCCCTCGACCTCGTCAACTTCGACTACGAGCACGCCAACCAGATCGCA
GGCGGAGACGCCGTCGCCCTGGCAAAGAACTTCAAGGCAAACGTCCGTTTCATCTCGGGCATCGGCGCCGAGTAC
GACGGAAGCGCCATCAACCACATCGACGGTTCCCCCTCCGACGCCTCTTCGTCCACCGTCGGCGGCGACGCCCGT
CCGGGATGCTTACTGCCGCCGGCCAAGGTGACGCGTTACATCGACTCCAACCCGGTCGACATCCAGCTCGACATT
CCCATGCTAGGCCAGTTCCGCGTCTTCCTCCTCATGTGGGACGTCCAGCAGGCGGCTCCCTTCCTCGCCACCTTT
TGCCGCGCCGTCGCAGGTGACGGCTCCCTGATGAGCCAGCTATCGGCCGCCGCCAGCGCCTCGTACGCTGCTCAG
CCCCGTCTGGGTTCGCCCGAAGACGTCTACATCCGCCCGGAGCGGTACACCGCCGTCAGCCACCTCTTTACCTTT
GCCCTCATCACAACAATGGCCAAGGCAGAGATGGAAATCTCCGACCTCCCCGCCCTCCTCCAAGACAGCCGCTGG
ACCCTCTACCTCGACGACGTACCCGAAAAGGACACGCGCGGCCAGCTCTGCACCGACAAGTGGCTCGGCAGCCTG
GAACCGGGCGAGGTGGCCGTCGTCAACGTCCGTCCGGACGGCTACGTCGGCTCCGTCGGCCGCTGGGACTCGAGC
GTCGACGATGCTGGCGAGCAGGCTGCTCGTTGGCTCGATGCTTACTACGGAGGCTTCATGCGAGTTCCCGCCGCG
GCCGAGACGTGA
Gene >Ophcf2|00344
ATGGCGCCTGGCATCCTCCATGGAAGCCCGTCGCTCGATAGCCCCATTGTCGACGTCGAGCACCAGCTGGCCCCC
GTCGACGAGGCCAAGGAGATGGACGCCGTCGCCGACCTCACCATGCTACGGAGCTTCCCCGAGCCGCCCGTCGAG
TGTCAGGTCTGCGTCGTCGGAGCCGGTCCAGCCGGTCTCATGCTGGCCGCCACCCTCGGCCGCTGCGGTATCCGC
GTCGAGGTCATTGACGACCGAGCCGATCAGACGCCAGTCGGAAGGTAGTCCGCCAGCCTTCGCCGCATCCGACCG
ACGCTTACCCGCTCTCCCAGGGCCGACGGCCTGCAGCCCAAGACCATCGAGACCCTGAGGCAGCTTCGCATCGCC
GACACACTGCTCCAGCGCGGCGTCCGCGTCTTCGACATTTCCTTCTGGCGCAGCACCGCCACTGAGCCGCTTCAC
CGCCTCGGCCGCGAAGTTCACTATCCGCCTGTCATTGACGTCTTGGACCCCTACATTCTGTTGGTTCACCAGGGC
ATCGTCGAGAGCCTCTTCATCGACGACATGCGGAAGCGCGGCAGGGAGGTCCGTCGGAATACCGCCTTTGAATCG
TACGACCACGTCGCCGGCAAGTCGGGGCAGATTCAGGTCAACTGCCGCACCAACGTGAACCACGATAAGCGGACC
ATTCTCGCGCAGTACCTAGTTGGCTGTGAGTTTCTCTCTCTCTCCCTCTCTCTCTCTCCCTCTCTCTCTCTCCCC
ACATCTCTCTCTCTCCCCACATCTCTCTCTCTCCCCACATCTCTCACCTCTGCATACCTACCTACCCCTTTTCGA
CGTGACACCATCTTCCCTCCCAACGCTCAACTCTTCCTTTCAGGCGACGGTGCCCACTCCAAGGTGCGCAAGAGC
ATGCCCGACGTCGAGGCCGTGGGCATGTCCCAGGCCGCCATCTGGGGTGTTCTCGACGGCGAGCTCATCACCGAC
TTCCCCGACATCTGGTCCAAGACGCTCGTCTACTCGGAAGAGCACGGGTCCATCCTCATCATCCCGCGAGAGCGC
AACATGACGCGCCTCATCATCCCGCGAGAGCGCAACATGACGCGCTTCTACATCGAGCTCAAGGCGTGCGCCACG
ACGGACCGCCGGCAGCTCGGCCAGAGCTTTGTCATGCAACAGGCGAGGAAAATAATGGCGCCTTTCTCCGTCGAC
TGGCGGTATATCGAGTGGTTCGGCCGGTATCAGGTCGGGCAGCGCGTAGCGAGCCGCTTCTCCGACGCAAAGACG
CGCGTCTTCTTGTCAGGCGATGCCAGTCACACGCACTCGCCCAAGGCGGCGCAGGGCATGAACACGTCGATGCAC
GACTCTTGGAACCTCGGCTGGAAGCTCAACCTGGCCGTCCGCGGTCTGGCCAAACCCGAGCTTCTGCAGAGCTAC
GACGAGGAGAGGCGCAAGATCGCCCTCGACCTCGTCAACTTCGACTACGAGCACGCCAACCAGATCGCAGGCGGA
GACGCCGTCGCCCTGGCAAAGAACTTCAAGGCAAACGTCCGTTTCATCTCGGGCATCGGCGCCGAGTACGACGGA
AGCGCCATCAACCACATCGACGGTTCCCCCTCCGACGCCTCTTCGTCCACCGTCGGCGGCGACGCCCGTCCGGGA
TGCTTACTGCCGCCGGCCAAGGTGACGCGTTACATCGACTCCAACCCGGTCGACATCCAGCTCGACATTCCCATG
CTAGGCCAGTTCCGCGTCTTCCTCCTCATGTGGGACGTCCAGCAGGCGGCTCCCTTCCTCGCCACCTTTTGCCGC
GCCGTCGCAGGTGACGGCTCCCTGATGAGCCAGCTATCGGCCGCCGCCAGCGCCTCGTACGCTGCTCAGCCCCGT
CTGGGTTCGCCCGAAGACGTCTACATCCGCCCGGAGCGGTACACCGCCGTCAGCCACCTCTTTACCTTTGCCCTC
ATCAGTGAGTTTCCCTCCCCTCCCCCCCCCCCCCCCTTGCTCACAACGGATTAAAAAAAAAAAAAAAAAAAACAG
CAACAATGGCCAAGGCAGAGATGGAAATCTCCGACCTCCCCGCCCTCCTCCAAGACAGCCGCTGGACCCTCTACC
TCGACGACGTACCCGAAAAGGACACGCGCGGCCAGCTCTGCACCGACAAGTGGCTCGGCAGCCTGGAACCGGGCG
AGGTGGCCGTCGTCAACGTCCGTCCGGACGGCTACGTCGGCTCCGTCGGCCGCTGGGACTCGAGCGTCGACGATG
CTGGCGAGCAGGCTGCTCGTTGGCTCGATGCTTACTACGGAGGCTTCATGCGAGTTCCCGCCGCGGCCGAGACGT
GA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail