Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00343
Gene name
Locationscaffold_01:1526457..1528197
Strand+
Gene length (bp)1740
Transcript length (bp)1683
Coding sequence length (bp)1683
Protein length (aa) 561

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00171 Aldedh Aldehyde dehydrogenase family 2.0E-133 76 538

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2179 0.1429 0.064 0.0471 0.8622 0.0919 0.0488 0.0593 0.0959 0.0529

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1008
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|478
Ophiocordyceps australis map64 (Brazil) OphauB2|4670
Ophiocordyceps camponoti-floridani Ophcf2|00343 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1839
Ophiocordyceps kimflemingae Ophio5|8591
Ophiocordyceps subramaniannii Hirsu2|8917

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00343
MRRLLARSLISNPSARLRMPSSSQSSSAARRLHATAQHLRPAPALASTTTHFPTSHETFRNVTNTPYFMDNKLLE
SQADSFIDVTDPATNRVVTRVPHMNPDEMKAAVASAQRAFDSWRTTTVLARQQIMFRFVQLIRDNWERLAASITQ
EQGKTLDDARGDVLRGLQVAEAAIAAPELLKGEVLEVARDMETRTYREPLGVVAAICPFNFPAMIPLWCIPMATV
TGNTLILKPSERDPGAAMILAELVQKAGFPDGVVNVIHGAHRTVDFLLDEPAIKAISFVGGNKAGEYIYTRASAN
GKRVQANLGAKNHAAVLPDCNKNHFINSVVGAAFGAAGQRCMALSTLVMVGETRDWLPDLADRARRLNVNGGFER
GADLGPVISPQSKERIESIIESAAREGATILLDGRGCRPAKYPDGNFVGPTIISNVKPSMRCYRDEIFGPVLVCL
NVDTLEQAVDLINQNEYGNGVAIFTRSGAAAESFRRTIQAGQVGVNVPIPVPLPMFSFTGNKRSVAGGGANTFYG
RPAVNFYTQLKTVTSFWKASDAEGMKAAVHMPTLE*
Coding >Ophcf2|00343
ATGCGCCGGCTCCTCGCGCGAAGCCTCATCTCGAACCCGTCCGCTCGGCTCAGGATGCCGTCGTCTTCTCAATCC
TCTTCGGCCGCTCGGAGGCTTCATGCGACGGCTCAACATCTTCGACCGGCGCCCGCCCTGGCATCCACAACGACG
CATTTTCCGACGTCACACGAGACGTTCCGAAATGTCACCAACACGCCCTACTTCATGGACAACAAGCTGCTCGAG
TCCCAGGCTGATAGCTTCATTGACGTGACCGATCCGGCCACAAACAGGGTGGTGACGCGCGTGCCGCACATGAAC
CCCGATGAGATGAAGGCCGCCGTGGCCAGCGCTCAGCGTGCCTTTGATTCGTGGCGGACGACGACGGTCTTGGCC
AGGCAGCAGATTATGTTTCGCTTCGTGCAGCTGATCCGCGACAACTGGGAGCGGCTGGCGGCCAGCATCACGCAG
GAGCAGGGAAAGACGCTGGACGATGCCAGGGGCGACGTCCTCCGTGGCTTACAGGTTGCCGAGGCTGCCATTGCC
GCGCCCGAGCTGCTCAAGGGCGAGGTGCTCGAGGTGGCCCGCGACATGGAGACGCGGACATACCGAGAGCCGCTG
GGCGTCGTGGCCGCAATCTGTCCCTTTAACTTCCCCGCCATGATCCCCCTCTGGTGCATCCCCATGGCCACCGTC
ACGGGCAACACGCTCATCCTCAAGCCTTCCGAGCGTGATCCAGGCGCCGCCATGATCCTCGCCGAGCTCGTTCAA
AAGGCCGGCTTCCCCGACGGTGTCGTAAACGTCATCCACGGAGCCCACCGCACCGTCGACTTCCTCCTCGACGAG
CCGGCCATCAAGGCCATCAGCTTCGTCGGCGGCAACAAGGCCGGCGAGTACATCTACACGCGCGCCTCGGCCAAC
GGAAAGCGCGTACAGGCCAACCTGGGCGCCAAGAACCACGCGGCCGTGTTGCCGGACTGCAATAAGAATCACTTC
ATCAACAGCGTGGTGGGCGCCGCCTTTGGAGCCGCGGGCCAGCGCTGCATGGCTCTCAGCACCCTCGTCATGGTG
GGCGAGACCAGGGACTGGCTACCCGACCTTGCCGATCGCGCGCGCCGCCTGAATGTCAACGGCGGCTTCGAGCGC
GGTGCCGACCTGGGACCCGTCATCTCGCCCCAGAGCAAGGAACGCATCGAGTCCATCATCGAGAGCGCAGCCCGC
GAGGGCGCCACCATACTGCTCGACGGCCGCGGCTGCCGACCTGCCAAGTATCCCGACGGCAACTTCGTCGGCCCA
ACCATCATCTCCAACGTCAAGCCTTCGATGAGGTGCTATCGCGACGAGATCTTCGGCCCCGTCCTCGTCTGCCTC
AACGTCGACACTCTCGAACAGGCCGTCGACCTCATCAACCAAAACGAGTACGGCAATGGCGTCGCCATCTTCACC
CGCTCAGGCGCCGCCGCGGAGTCGTTCCGCAGGACCATCCAGGCCGGCCAGGTGGGCGTCAACGTGCCCATCCCC
GTACCGCTGCCCATGTTCTCCTTCACGGGGAACAAGAGGAGCGTGGCGGGCGGCGGGGCCAATACTTTCTACGGG
AGGCCTGCTGTCAATTTCTACACGCAGCTCAAGACGGTGACGTCGTTTTGGAAGGCTTCTGATGCAGAGGGGATG
AAGGCGGCTGTTCATATGCCGACTTTGGAGTGA
Transcript >Ophcf2|00343
ATGCGCCGGCTCCTCGCGCGAAGCCTCATCTCGAACCCGTCCGCTCGGCTCAGGATGCCGTCGTCTTCTCAATCC
TCTTCGGCCGCTCGGAGGCTTCATGCGACGGCTCAACATCTTCGACCGGCGCCCGCCCTGGCATCCACAACGACG
CATTTTCCGACGTCACACGAGACGTTCCGAAATGTCACCAACACGCCCTACTTCATGGACAACAAGCTGCTCGAG
TCCCAGGCTGATAGCTTCATTGACGTGACCGATCCGGCCACAAACAGGGTGGTGACGCGCGTGCCGCACATGAAC
CCCGATGAGATGAAGGCCGCCGTGGCCAGCGCTCAGCGTGCCTTTGATTCGTGGCGGACGACGACGGTCTTGGCC
AGGCAGCAGATTATGTTTCGCTTCGTGCAGCTGATCCGCGACAACTGGGAGCGGCTGGCGGCCAGCATCACGCAG
GAGCAGGGAAAGACGCTGGACGATGCCAGGGGCGACGTCCTCCGTGGCTTACAGGTTGCCGAGGCTGCCATTGCC
GCGCCCGAGCTGCTCAAGGGCGAGGTGCTCGAGGTGGCCCGCGACATGGAGACGCGGACATACCGAGAGCCGCTG
GGCGTCGTGGCCGCAATCTGTCCCTTTAACTTCCCCGCCATGATCCCCCTCTGGTGCATCCCCATGGCCACCGTC
ACGGGCAACACGCTCATCCTCAAGCCTTCCGAGCGTGATCCAGGCGCCGCCATGATCCTCGCCGAGCTCGTTCAA
AAGGCCGGCTTCCCCGACGGTGTCGTAAACGTCATCCACGGAGCCCACCGCACCGTCGACTTCCTCCTCGACGAG
CCGGCCATCAAGGCCATCAGCTTCGTCGGCGGCAACAAGGCCGGCGAGTACATCTACACGCGCGCCTCGGCCAAC
GGAAAGCGCGTACAGGCCAACCTGGGCGCCAAGAACCACGCGGCCGTGTTGCCGGACTGCAATAAGAATCACTTC
ATCAACAGCGTGGTGGGCGCCGCCTTTGGAGCCGCGGGCCAGCGCTGCATGGCTCTCAGCACCCTCGTCATGGTG
GGCGAGACCAGGGACTGGCTACCCGACCTTGCCGATCGCGCGCGCCGCCTGAATGTCAACGGCGGCTTCGAGCGC
GGTGCCGACCTGGGACCCGTCATCTCGCCCCAGAGCAAGGAACGCATCGAGTCCATCATCGAGAGCGCAGCCCGC
GAGGGCGCCACCATACTGCTCGACGGCCGCGGCTGCCGACCTGCCAAGTATCCCGACGGCAACTTCGTCGGCCCA
ACCATCATCTCCAACGTCAAGCCTTCGATGAGGTGCTATCGCGACGAGATCTTCGGCCCCGTCCTCGTCTGCCTC
AACGTCGACACTCTCGAACAGGCCGTCGACCTCATCAACCAAAACGAGTACGGCAATGGCGTCGCCATCTTCACC
CGCTCAGGCGCCGCCGCGGAGTCGTTCCGCAGGACCATCCAGGCCGGCCAGGTGGGCGTCAACGTGCCCATCCCC
GTACCGCTGCCCATGTTCTCCTTCACGGGGAACAAGAGGAGCGTGGCGGGCGGCGGGGCCAATACTTTCTACGGG
AGGCCTGCTGTCAATTTCTACACGCAGCTCAAGACGGTGACGTCGTTTTGGAAGGCTTCTGATGCAGAGGGGATG
AAGGCGGCTGTTCATATGCCGACTTTGGAGTGA
Gene >Ophcf2|00343
ATGCGCCGGCTCCTCGCGCGAAGCCTCATCTCGAACCCGTCCGCTCGGCTCAGGATGCCGTCGTCTTCTCAATCC
TCTTCGGCCGCTCGGAGGCTTCATGCGACGGCTCAACATCTTCGACCGGCGCCCGCCCTGGCATCCACAACGACG
CATTTTCCGACGTCACACGAGACGTTCCGAAATGTCACCAACACGCCCTACTTCATGGACAACAAGCTGCTCGAG
TCCCAGGCTGATAGCTTCATTGACGTGACCGATCCGGCCACAAACAGGGTGGTGACGCGCGTGCCGCACATGAAC
CCCGATGAGATGAAGGCCGCCGTGGCCAGCGCTCAGCGTGCCTTTGATTCGTGGCGGACGACGACGGTCTTGGCC
AGGCAGCAGATTATGTTTCGCTTCGTGCAGCTGATCCGCGACAACTGGGAGCGGCTGGCGGCCAGCATCACGCAG
GAGCAGGGAAAGACGCTGGACGATGCCAGGGGCGACGTCCTCCGTGGCTTACAGGTTGCCGAGGCTGCCATTGCC
GCGCCCGAGCTGCTCAAGGGCGAGGTGCTCGAGGTGGCCCGCGACATGGAGACGCGGACATACCGAGAGCCGCTG
GGCGTCGTGGCCGCAATCTGTCCCTTTAGTGAGCCGTGGATCCCCGCTACGGGAACGGTTTGCATGATGGCTGAC
GCCGACACAGACTTCCCCGCCATGATCCCCCTCTGGTGCATCCCCATGGCCACCGTCACGGGCAACACGCTCATC
CTCAAGCCTTCCGAGCGTGATCCAGGCGCCGCCATGATCCTCGCCGAGCTCGTTCAAAAGGCCGGCTTCCCCGAC
GGTGTCGTAAACGTCATCCACGGAGCCCACCGCACCGTCGACTTCCTCCTCGACGAGCCGGCCATCAAGGCCATC
AGCTTCGTCGGCGGCAACAAGGCCGGCGAGTACATCTACACGCGCGCCTCGGCCAACGGAAAGCGCGTACAGGCC
AACCTGGGCGCCAAGAACCACGCGGCCGTGTTGCCGGACTGCAATAAGAATCACTTCATCAACAGCGTGGTGGGC
GCCGCCTTTGGAGCCGCGGGCCAGCGCTGCATGGCTCTCAGCACCCTCGTCATGGTGGGCGAGACCAGGGACTGG
CTACCCGACCTTGCCGATCGCGCGCGCCGCCTGAATGTCAACGGCGGCTTCGAGCGCGGTGCCGACCTGGGACCC
GTCATCTCGCCCCAGAGCAAGGAACGCATCGAGTCCATCATCGAGAGCGCAGCCCGCGAGGGCGCCACCATACTG
CTCGACGGCCGCGGCTGCCGACCTGCCAAGTATCCCGACGGCAACTTCGTCGGCCCAACCATCATCTCCAACGTC
AAGCCTTCGATGAGGTGCTATCGCGACGAGATCTTCGGCCCCGTCCTCGTCTGCCTCAACGTCGACACTCTCGAA
CAGGCCGTCGACCTCATCAACCAAAACGAGTACGGCAATGGCGTCGCCATCTTCACCCGCTCAGGCGCCGCCGCG
GAGTCGTTCCGCAGGACCATCCAGGCCGGCCAGGTGGGCGTCAACGTGCCCATCCCCGTACCGCTGCCCATGTTC
TCCTTCACGGGGAACAAGAGGAGCGTGGCGGGCGGCGGGGCCAATACTTTCTACGGGAGGCCTGCTGTCAATTTC
TACACGCAGCTCAAGACGGTGACGTCGTTTTGGAAGGCTTCTGATGCAGAGGGGATGAAGGCGGCTGTTCATATG
CCGACTTTGGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail