Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00342
Gene name
Locationscaffold_01:1523751..1525651
Strand+
Gene length (bp)1900
Transcript length (bp)1695
Coding sequence length (bp)1695
Protein length (aa) 565

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00262 Calreticulin Calreticulin family 8.5E-167 46 416

GO

GO Term Description Terminal node
GO:0006457 protein folding Yes
GO:0051082 unfolded protein binding Yes
GO:0005509 calcium ion binding Yes
GO:0005783 endoplasmic reticulum Yes
GO:0005515 protein binding No
GO:0043169 cation binding No
GO:0043226 organelle No
GO:0005488 binding No
GO:0110165 cellular anatomical entity No
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0043229 intracellular organelle No
GO:0043227 membrane-bounded organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 494 513 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00342
MKLNALAAATSAALLVGSVQADEAQKPLAPVDDLPKFTPTTLKAPFLEQFTDGWDKRWKPSHAKKDMKDAAKDGE
EWAYVGEWAVEEPTKYKGMEGDRGLVVKNPAAHHAISAKFPSKIDNKGKTLVVQYEVKLQNGLECGGAYMKLLRD
NKALHQDEFSNTTPYVVMFGPDKCGHTNKVHFIINHKNPKTGEYEEKHLSSPPTAKIVKTTELYTLIVHPNNSYA
IKQNREEVKSGSLFEDFVPEINPPAEIDDPKDTKPDDWVDKARIPDPDAKKPQDWDEDAPYEIVDEEATMPEDWL
EKEPATIPDPEAQKPEDWNDDDDGDWEAPSVPNPKCADASGCGPWTKPMKKNPAYKGKWTAPFIDNPEYKGPWAP
RKIKNPDYFEDKTPANLEPMGAIGFEIWTMQSDILFDNIYIGHSIEDADKLAAETWAVKHPVEMKQADADKPKDE
DKPPSPLDIKFLDDPVLYVKEKVGLFMSIAQNDPVGAVKFVPEVAGGIVAVAATLIALLVGLVSKGASSPAVKKA
ATDVKEKAKEVKDAAAEATTTGAEKAKAEVTKRTTRSQS*
Coding >Ophcf2|00342
ATGAAGCTCAACGCCCTCGCGGCCGCCACTTCGGCTGCCCTCCTCGTCGGCTCCGTCCAGGCTGACGAGGCTCAG
AAGCCGCTCGCGCCGGTCGACGACCTGCCCAAGTTCACCCCTACCACCCTCAAGGCCCCCTTCCTCGAGCAGTTC
ACCGACGGCTGGGACAAGAGATGGAAGCCTTCGCACGCCAAAAAGGACATGAAGGACGCGGCCAAGGATGGCGAG
GAGTGGGCCTACGTCGGCGAGTGGGCTGTCGAGGAGCCCACCAAGTACAAGGGCATGGAAGGCGACCGAGGCCTC
GTCGTCAAGAACCCGGCCGCTCATCATGCCATCTCGGCCAAGTTCCCCAGCAAGATCGACAACAAGGGCAAGACG
CTGGTCGTTCAGTACGAAGTCAAGCTGCAGAACGGTCTCGAGTGCGGCGGCGCCTACATGAAGCTGCTGCGCGAC
AACAAGGCTCTCCACCAGGATGAGTTTAGCAACACGACGCCCTACGTCGTCATGTTCGGTCCCGACAAGTGCGGC
CACACCAACAAGGTGCACTTCATCATCAACCACAAGAACCCCAAGACGGGCGAGTATGAAGAGAAGCATCTGTCC
AGCCCGCCCACGGCCAAGATCGTCAAGACGACCGAACTTTACACGCTCATTGTTCACCCCAACAACTCGTATGCC
ATCAAGCAGAACCGCGAGGAGGTCAAGTCGGGCTCTCTCTTTGAGGACTTTGTCCCCGAGATCAACCCGCCCGCC
GAGATTGACGACCCCAAGGACACCAAGCCCGACGACTGGGTTGACAAGGCTCGCATCCCCGATCCCGACGCCAAG
AAGCCCCAAGACTGGGACGAGGACGCCCCGTACGAGATTGTCGATGAGGAGGCCACCATGCCCGAAGACTGGCTC
GAAAAGGAGCCCGCCACTATTCCCGACCCCGAGGCCCAGAAGCCCGAGGACTGGAACGACGACGACGACGGCGAC
TGGGAGGCTCCCAGCGTGCCCAACCCCAAGTGCGCCGACGCCTCGGGCTGCGGCCCCTGGACCAAGCCCATGAAG
AAGAACCCCGCCTACAAGGGCAAGTGGACGGCCCCTTTCATCGACAATCCCGAATACAAGGGTCCCTGGGCTCCT
CGCAAGATCAAGAACCCCGACTACTTCGAGGACAAGACGCCCGCTAACCTTGAGCCCATGGGCGCTATTGGCTTC
GAAATCTGGACCATGCAAAGCGACATCCTGTTCGACAACATCTACATCGGCCACTCGATCGAGGACGCGGACAAG
CTGGCGGCCGAGACGTGGGCCGTCAAGCACCCCGTCGAGATGAAGCAGGCCGACGCGGACAAGCCCAAGGATGAA
GACAAGCCCCCTTCGCCCCTTGACATCAAGTTCCTCGACGATCCGGTCCTGTACGTCAAGGAGAAGGTGGGCCTG
TTCATGTCGATTGCGCAGAACGACCCCGTCGGGGCGGTCAAGTTCGTGCCCGAGGTGGCGGGCGGCATCGTGGCG
GTGGCGGCGACGCTGATTGCCCTCTTGGTCGGCCTGGTCAGCAAGGGCGCGTCTTCTCCGGCCGTCAAGAAGGCG
GCGACGGATGTCAAGGAAAAGGCCAAGGAGGTCAAGGACGCGGCGGCTGAGGCGACGACGACGGGTGCCGAAAAG
GCAAAGGCCGAGGTGACGAAGCGCACGACTCGCAGTCAGTCGTAG
Transcript >Ophcf2|00342
ATGAAGCTCAACGCCCTCGCGGCCGCCACTTCGGCTGCCCTCCTCGTCGGCTCCGTCCAGGCTGACGAGGCTCAG
AAGCCGCTCGCGCCGGTCGACGACCTGCCCAAGTTCACCCCTACCACCCTCAAGGCCCCCTTCCTCGAGCAGTTC
ACCGACGGCTGGGACAAGAGATGGAAGCCTTCGCACGCCAAAAAGGACATGAAGGACGCGGCCAAGGATGGCGAG
GAGTGGGCCTACGTCGGCGAGTGGGCTGTCGAGGAGCCCACCAAGTACAAGGGCATGGAAGGCGACCGAGGCCTC
GTCGTCAAGAACCCGGCCGCTCATCATGCCATCTCGGCCAAGTTCCCCAGCAAGATCGACAACAAGGGCAAGACG
CTGGTCGTTCAGTACGAAGTCAAGCTGCAGAACGGTCTCGAGTGCGGCGGCGCCTACATGAAGCTGCTGCGCGAC
AACAAGGCTCTCCACCAGGATGAGTTTAGCAACACGACGCCCTACGTCGTCATGTTCGGTCCCGACAAGTGCGGC
CACACCAACAAGGTGCACTTCATCATCAACCACAAGAACCCCAAGACGGGCGAGTATGAAGAGAAGCATCTGTCC
AGCCCGCCCACGGCCAAGATCGTCAAGACGACCGAACTTTACACGCTCATTGTTCACCCCAACAACTCGTATGCC
ATCAAGCAGAACCGCGAGGAGGTCAAGTCGGGCTCTCTCTTTGAGGACTTTGTCCCCGAGATCAACCCGCCCGCC
GAGATTGACGACCCCAAGGACACCAAGCCCGACGACTGGGTTGACAAGGCTCGCATCCCCGATCCCGACGCCAAG
AAGCCCCAAGACTGGGACGAGGACGCCCCGTACGAGATTGTCGATGAGGAGGCCACCATGCCCGAAGACTGGCTC
GAAAAGGAGCCCGCCACTATTCCCGACCCCGAGGCCCAGAAGCCCGAGGACTGGAACGACGACGACGACGGCGAC
TGGGAGGCTCCCAGCGTGCCCAACCCCAAGTGCGCCGACGCCTCGGGCTGCGGCCCCTGGACCAAGCCCATGAAG
AAGAACCCCGCCTACAAGGGCAAGTGGACGGCCCCTTTCATCGACAATCCCGAATACAAGGGTCCCTGGGCTCCT
CGCAAGATCAAGAACCCCGACTACTTCGAGGACAAGACGCCCGCTAACCTTGAGCCCATGGGCGCTATTGGCTTC
GAAATCTGGACCATGCAAAGCGACATCCTGTTCGACAACATCTACATCGGCCACTCGATCGAGGACGCGGACAAG
CTGGCGGCCGAGACGTGGGCCGTCAAGCACCCCGTCGAGATGAAGCAGGCCGACGCGGACAAGCCCAAGGATGAA
GACAAGCCCCCTTCGCCCCTTGACATCAAGTTCCTCGACGATCCGGTCCTGTACGTCAAGGAGAAGGTGGGCCTG
TTCATGTCGATTGCGCAGAACGACCCCGTCGGGGCGGTCAAGTTCGTGCCCGAGGTGGCGGGCGGCATCGTGGCG
GTGGCGGCGACGCTGATTGCCCTCTTGGTCGGCCTGGTCAGCAAGGGCGCGTCTTCTCCGGCCGTCAAGAAGGCG
GCGACGGATGTCAAGGAAAAGGCCAAGGAGGTCAAGGACGCGGCGGCTGAGGCGACGACGACGGGTGCCGAAAAG
GCAAAGGCCGAGGTGACGAAGCGCACGACTCGCAGTCAGTCGTAG
Gene >Ophcf2|00342
ATGAAGCTCAACGCCCTCGCGGCCGCCACTTCGGCTGCCCTCCTCGTCGGCTCCGTCCAGGCTGACGAGGCTCAG
AAGCCGCTCGCGCCGGTCGACGACCTGCCCAAGTTCACCGTGAGTTCCGTTCGGGCCTGGCCTGCTCCGGTCACC
CATCGCTGACGCGCCTCCCGCCGCCAGCCTACCACCCTCAAGGCCCCCTTCCTCGAGCAGTTCACCGACGGCTGG
GACAAGAGATGGAAGCCTTCGCACGCCAAAAAGGACATGAAGGACGCGGCCAAGGATGGCGAGGAGTGGGCCTAC
GTCGGCGAGTGGGCTGTCGAGGAGCCCACCAAGTACAAGGGCATGGAAGGCGACCGAGGCCTCGTCGTCAAGAAC
CCGGCCGCTCATCATGCCATCTCGGCCAAGTTCCCCAGCAAGATCGACAACAAGGGCAAGACGCTGGTCGTTCAG
TACGAAGTCAAGCTGCAGAGTATGAGCCGCTCCACTTGTTGCACATGAAACCCTCATCATGAACCCCCCCCAAAA
CCTAACTCGTCAACTCGTCCAGACGGTCTCGAGTGCGGCGGCGCCTACATGAAGCTGCTGCGCGACAACAAGGCT
CTCCACCAGGATGAGTTTAGCAACACGACGCCCTACGTCGTCATGTTCGGTCCCGACAAGTGCGGCCACACCAAC
AAGGTGCACTTCATCATCAACCACAAGAACCCCAAGACGGGCGAGTATGAAGAGAAGCATCTGTCCAGCCCGCCC
ACGGCCAAGATCGTCAAGACGACCGAACTTTACACGCTCATTGTTCACCCCAACAACTCGTATGCCATCAAGCAG
AACCGCGAGGAGGTCAAGTCGGGCTCTCTCTTTGAGGACTTTGTCCCCGAGATCAACCCGCCCGCCGAGATTGAC
GACCCCAAGGACACCAAGCCCGACGACTGGGTTGACAAGGCTCGCATCCCCGATCCCGACGCCAAGAAGCCCCAA
GACTGGGACGAGGACGCCCCGTACGAGATTGTCGATGAGGAGGCCACCATGCCCGAAGACTGGCTCGAAAAGGAG
CCCGCCACTATTCCCGACCCCGAGGCCCAGAAGCCCGAGGACTGGAACGACGACGACGACGGCGACTGGGAGGCT
CCCAGCGTGCCCAACCCCAAGTGCGCCGACGCCTCGGGCTGCGGCCCCTGGACCAAGCCCATGAAGAAGAACCCC
GCCTACAAGGGCAAGTGGACGGCCCCTTTCATCGACAATCCCGAATACAAGGGTCCCTGGGCTCCTCGCAAGATC
AAGAACCCCGACTACTTCGAGGACAAGACGCCCGCTAACCTTGAGCCCATGGGCGCTGTGAGTTTCCCGACGGCG
TGCTGGGAGCGGGCGTTGAGCCGTTGCTGACGATGACGGATGATAGATTGGCTTCGAAATCTGGACCATGCAAAG
CGACATCCTGTTCGACAACATCTACATCGGCCACTCGATCGAGGACGCGGACAAGCTGGCGGCCGAGACGTGGGC
CGTCAAGCACCCCGTCGAGATGAAGCAGGCCGACGCGGACAAGCCCAAGGATGAAGACAAGCCCCCTTCGCCCCT
TGACATCAAGTTCCTCGACGATCCGGTCCTGTACGTCAAGGAGAAGGTGGGCCTGTTCATGTCGATTGCGCAGAA
CGACCCCGTCGGGGCGGTCAAGTTCGTGCCCGAGGTGGCGGGCGGCATCGTGGCGGTGGCGGCGACGCTGATTGC
CCTCTTGGTCGGCCTGGTCAGCAAGGGCGCGTCTTCTCCGGCCGTCAAGAAGGCGGCGACGGATGTCAAGGAAAA
GGCCAAGGAGGTCAAGGACGCGGCGGCTGAGGCGACGACGACGGGTGCCGAAAAGGCAAAGGCCGAGGTGACGAA
GCGCACGACTCGCAGTCAGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail