Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00332
Gene name
Locationscaffold_01:1504766..1505153
Strand-
Gene length (bp)387
Transcript length (bp)294
Coding sequence length (bp)294
Protein length (aa) 98

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10780 MRP_L53 39S ribosomal protein L53/MRP-L53 5.4E-18 14 63

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.3459 0.3406 0.0082 0.0684 0.9316 0.0074 0.0353 0.1013 0.0599 0.0135

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2722
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7173
Ophiocordyceps australis map64 (Brazil) OphauB2|2114
Ophiocordyceps camponoti-floridani Ophcf2|00332 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3506
Ophiocordyceps kimflemingae Ophio5|6947
Ophiocordyceps subramaniannii Hirsu2|4278

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00332
MITKYLTEVTAKLNPFSPCAKSARLFLTHLPPDIRSHGTAVSTQLIPRSSKESSSVIVKFKDGKQLEFDGDKMTI
KGMINEVDRLSRQLQKMEDISG*
Coding >Ophcf2|00332
ATGATCACAAAGTACCTCACCGAAGTCACAGCAAAGCTCAATCCCTTCTCCCCATGCGCCAAATCAGCCCGCCTC
TTCCTCACCCACCTACCGCCAGACATCCGCTCCCACGGCACCGCCGTCTCGACGCAGCTGATTCCGCGCTCCTCC
AAGGAGTCCAGCTCCGTCATTGTCAAGTTCAAGGACGGCAAGCAGCTCGAGTTTGACGGCGACAAGATGACCATC
AAGGGCATGATCAATGAAGTTGACCGGCTCTCTCGCCAATTGCAAAAGATGGAAGACATCTCCGGCTAA
Transcript >Ophcf2|00332
ATGATCACAAAGTACCTCACCGAAGTCACAGCAAAGCTCAATCCCTTCTCCCCATGCGCCAAATCAGCCCGCCTC
TTCCTCACCCACCTACCGCCAGACATCCGCTCCCACGGCACCGCCGTCTCGACGCAGCTGATTCCGCGCTCCTCC
AAGGAGTCCAGCTCCGTCATTGTCAAGTTCAAGGACGGCAAGCAGCTCGAGTTTGACGGCGACAAGATGACCATC
AAGGGCATGATCAATGAAGTTGACCGGCTCTCTCGCCAATTGCAAAAGATGGAAGACATCTCCGGCTAA
Gene >Ophcf2|00332
ATGATCACAAAGTACCTCACCGAAGTCACAGCAAAGCTCAATCCCTTCTCCCCATGCGCCAAATCAGCCCGCCTC
TTCCTCACCCACCTACCGCCAGACATCCGCTCCCACGGCACCGCCGTCTCGACGCAGCTGATTCCGCGCTCCTCC
AAGGAGTCCAGCTCCGTCATTGTCAAGTTCAGTGCGTTTCACCCCCACCATCGGTTTCTCTTCCTCCCAAGAGTG
GACGACGGCTCGGCCTTGCTGACACCCTTCTCCCCTCTTCGCTCGCCAGAGGACGGCAAGCAGCTCGAGTTTGAC
GGCGACAAGATGACCATCAAGGGCATGATCAATGAAGTTGACCGGCTCTCTCGCCAATTGCAAAAGATGGAAGAC
ATCTCCGGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail