Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00325
Gene name
Locationscaffold_01:1487114..1489569
Strand-
Gene length (bp)2455
Transcript length (bp)2268
Coding sequence length (bp)2268
Protein length (aa) 756

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09359 VTC VTC domain 5.4E-98 198 471
PF02656 DUF202 Domain of unknown function (DUF202) 3.8E-11 650 714

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 686 708 22
2 728 747 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00325
MKFGEQLRSSVIREYQWYYIDYNGLKAELKTAKVGGREWTEDDETRFVGKLEDELEKVHTKQQVKAMEISRRIAV
SEREVRDVVGRLNDRGLGDQGPCEEEFVLLEEDLGDIIAEVHDLAKFVQLNYTGFYKIIKKHDKMTGWHLRPAFD
TRLKAKPFYKENYDTSVIKLSTLYDLVRTRGNPVQGDSAAGGSQASFVRQTTKYWVHPDNVTELKLIILKHLPVL
VFNAAKAFEQQDSAITSIYFDNPDTWDLYEGRLKKTEGAEAIRLRWYGGMKTETVFVERKTHREDWTGEKSVKAR
FSVKEKNVNAYLSGELLPTALFDKARREGRKSEKAIAEDERLASEIQYAVLKRGYRPVCRSFYNRTAFQLPADAR
VRISLDTELTMMREDNLDGRRRCGDNWRRMDIGIDYPFAQLPPDDVVRFPYAVLEVKLQTQLGQEPPAWVRQLIS
SHLVEAVPKFSKFIHGAACLFPDRIHLLPFWMPQMDVDIRKPVTHDFGIRRRPGTAGTTTSSEDEEDLDSDDGAG
HDDDGPRQQPVNDAEGQTADDAHQGAADFPIYDSDDEYDENYELDEARRLGGRRYYSALVTAKARSLARGALSVV
KAVAPRPRPSRIPESQRQRQLFGPGAVVEQRRFRAPPGKKIYVPVRVEPKVYFAAERTFLGWLEYSIYVGAIAVT
LLNFGTRTSSLSFWSAAAFTLLALLSLSYSVVVYLYRSRAIRSRRAARYYDRWGPSVLCGALFAAVAVNFVLEGR
QRGLL*
Coding >Ophcf2|00325
ATGAAGTTCGGCGAGCAGCTGCGTTCCAGCGTCATCCGCGAGTATCAATGGTACTACATCGACTACAACGGCCTC
AAGGCCGAGCTCAAGACGGCCAAAGTCGGCGGTCGCGAATGGACAGAGGACGACGAGACGCGCTTCGTCGGCAAG
CTCGAGGACGAGCTGGAAAAGGTGCACACCAAGCAGCAGGTCAAGGCCATGGAGATCTCGCGCCGCATAGCAGTC
AGCGAGCGAGAGGTTCGCGACGTCGTCGGCCGCCTCAATGATCGCGGACTGGGCGATCAAGGGCCCTGCGAGGAA
GAGTTTGTCCTGCTGGAAGAGGACCTGGGCGACATCATCGCAGAGGTCCACGACCTGGCCAAGTTTGTCCAGCTC
AACTATACCGGATTCTATAAGATAATCAAGAAGCACGACAAAATGACGGGTTGGCACCTCCGGCCGGCCTTTGAC
ACGCGCCTCAAGGCGAAGCCCTTCTACAAGGAAAACTACGACACGTCCGTCATCAAGCTCTCGACGCTCTACGAC
CTCGTCCGCACCCGAGGCAACCCCGTCCAGGGCGACAGCGCCGCCGGAGGCTCCCAGGCCAGCTTCGTCAGGCAG
ACGACCAAGTACTGGGTCCATCCCGACAACGTGACGGAGCTCAAGCTCATCATCCTCAAGCACCTGCCCGTCCTC
GTCTTCAACGCGGCCAAGGCCTTTGAGCAGCAAGACTCGGCCATCACCTCCATCTACTTCGACAACCCGGACACG
TGGGACCTCTACGAGGGCCGACTCAAGAAGACCGAGGGCGCCGAGGCCATCCGACTACGCTGGTACGGAGGCATG
AAGACAGAGACCGTCTTCGTCGAGCGCAAGACGCACCGCGAGGACTGGACCGGCGAGAAGTCGGTCAAGGCCCGC
TTCTCCGTCAAGGAGAAGAACGTCAACGCCTACCTGAGCGGCGAGCTGCTGCCGACGGCCCTCTTCGACAAGGCC
CGCAGGGAGGGCCGCAAGTCGGAAAAGGCCATTGCCGAGGACGAGAGGCTGGCGTCGGAGATCCAGTACGCCGTG
CTCAAGAGGGGCTACCGGCCCGTCTGCCGCTCCTTTTATAACCGGACCGCCTTCCAGCTGCCGGCCGACGCCCGA
GTCCGCATCTCGCTCGATACCGAGCTGACCATGATGCGAGAGGACAACCTCGACGGCCGTCGGCGCTGCGGCGAC
AACTGGCGCCGCATGGACATTGGCATCGACTATCCCTTTGCCCAGCTGCCTCCCGACGACGTGGTCCGCTTCCCC
TACGCCGTGCTCGAGGTTAAGTTGCAGACGCAGCTGGGACAAGAGCCGCCGGCGTGGGTTCGTCAGCTCATCTCG
TCTCACCTGGTCGAGGCCGTTCCCAAGTTCTCCAAGTTTATCCACGGAGCCGCCTGTCTGTTCCCGGACCGCATC
CATCTTCTGCCCTTTTGGATGCCTCAGATGGACGTCGACATCCGGAAGCCAGTCACCCACGACTTTGGCATCCGT
CGGAGGCCAGGAACCGCCGGCACCACCACGTCGTCCGAGGACGAGGAGGACCTTGACTCGGATGACGGCGCTGGG
CACGACGATGACGGCCCTCGACAGCAGCCGGTCAACGACGCCGAGGGTCAGACTGCCGATGACGCCCACCAAGGC
GCCGCCGACTTTCCCATTTACGATTCGGACGACGAGTACGACGAGAACTACGAGCTCGACGAGGCACGACGACTG
GGCGGTCGCCGCTACTACTCGGCCCTCGTGACGGCAAAGGCCCGTTCCCTCGCCCGAGGCGCCCTCTCCGTCGTC
AAGGCCGTCGCTCCCCGTCCGCGCCCGTCGCGGATCCCGGAGTCGCAGCGGCAGCGGCAGCTCTTCGGCCCCGGA
GCCGTCGTCGAGCAGCGCCGCTTCCGGGCGCCTCCGGGCAAGAAGATTTACGTGCCGGTCCGGGTCGAGCCCAAG
GTCTACTTTGCCGCCGAGCGGACCTTTCTCGGATGGCTCGAGTACTCCATCTACGTAGGCGCCATCGCAGTCACC
CTCCTCAACTTCGGCACCCGCACCTCGTCCCTCTCCTTCTGGTCGGCCGCCGCCTTTACCCTGCTGGCGCTGCTG
AGCCTGTCCTACTCGGTCGTCGTCTATTTGTATCGAAGCCGGGCGATTCGGAGCCGGCGGGCGGCGCGGTACTAT
GATCGCTGGGGGCCTTCGGTCCTGTGCGGAGCGCTGTTTGCGGCCGTTGCTGTGAATTTTGTGCTCGAGGGGAGG
CAGAGGGGGTTGCTGTGA
Transcript >Ophcf2|00325
ATGAAGTTCGGCGAGCAGCTGCGTTCCAGCGTCATCCGCGAGTATCAATGGTACTACATCGACTACAACGGCCTC
AAGGCCGAGCTCAAGACGGCCAAAGTCGGCGGTCGCGAATGGACAGAGGACGACGAGACGCGCTTCGTCGGCAAG
CTCGAGGACGAGCTGGAAAAGGTGCACACCAAGCAGCAGGTCAAGGCCATGGAGATCTCGCGCCGCATAGCAGTC
AGCGAGCGAGAGGTTCGCGACGTCGTCGGCCGCCTCAATGATCGCGGACTGGGCGATCAAGGGCCCTGCGAGGAA
GAGTTTGTCCTGCTGGAAGAGGACCTGGGCGACATCATCGCAGAGGTCCACGACCTGGCCAAGTTTGTCCAGCTC
AACTATACCGGATTCTATAAGATAATCAAGAAGCACGACAAAATGACGGGTTGGCACCTCCGGCCGGCCTTTGAC
ACGCGCCTCAAGGCGAAGCCCTTCTACAAGGAAAACTACGACACGTCCGTCATCAAGCTCTCGACGCTCTACGAC
CTCGTCCGCACCCGAGGCAACCCCGTCCAGGGCGACAGCGCCGCCGGAGGCTCCCAGGCCAGCTTCGTCAGGCAG
ACGACCAAGTACTGGGTCCATCCCGACAACGTGACGGAGCTCAAGCTCATCATCCTCAAGCACCTGCCCGTCCTC
GTCTTCAACGCGGCCAAGGCCTTTGAGCAGCAAGACTCGGCCATCACCTCCATCTACTTCGACAACCCGGACACG
TGGGACCTCTACGAGGGCCGACTCAAGAAGACCGAGGGCGCCGAGGCCATCCGACTACGCTGGTACGGAGGCATG
AAGACAGAGACCGTCTTCGTCGAGCGCAAGACGCACCGCGAGGACTGGACCGGCGAGAAGTCGGTCAAGGCCCGC
TTCTCCGTCAAGGAGAAGAACGTCAACGCCTACCTGAGCGGCGAGCTGCTGCCGACGGCCCTCTTCGACAAGGCC
CGCAGGGAGGGCCGCAAGTCGGAAAAGGCCATTGCCGAGGACGAGAGGCTGGCGTCGGAGATCCAGTACGCCGTG
CTCAAGAGGGGCTACCGGCCCGTCTGCCGCTCCTTTTATAACCGGACCGCCTTCCAGCTGCCGGCCGACGCCCGA
GTCCGCATCTCGCTCGATACCGAGCTGACCATGATGCGAGAGGACAACCTCGACGGCCGTCGGCGCTGCGGCGAC
AACTGGCGCCGCATGGACATTGGCATCGACTATCCCTTTGCCCAGCTGCCTCCCGACGACGTGGTCCGCTTCCCC
TACGCCGTGCTCGAGGTTAAGTTGCAGACGCAGCTGGGACAAGAGCCGCCGGCGTGGGTTCGTCAGCTCATCTCG
TCTCACCTGGTCGAGGCCGTTCCCAAGTTCTCCAAGTTTATCCACGGAGCCGCCTGTCTGTTCCCGGACCGCATC
CATCTTCTGCCCTTTTGGATGCCTCAGATGGACGTCGACATCCGGAAGCCAGTCACCCACGACTTTGGCATCCGT
CGGAGGCCAGGAACCGCCGGCACCACCACGTCGTCCGAGGACGAGGAGGACCTTGACTCGGATGACGGCGCTGGG
CACGACGATGACGGCCCTCGACAGCAGCCGGTCAACGACGCCGAGGGTCAGACTGCCGATGACGCCCACCAAGGC
GCCGCCGACTTTCCCATTTACGATTCGGACGACGAGTACGACGAGAACTACGAGCTCGACGAGGCACGACGACTG
GGCGGTCGCCGCTACTACTCGGCCCTCGTGACGGCAAAGGCCCGTTCCCTCGCCCGAGGCGCCCTCTCCGTCGTC
AAGGCCGTCGCTCCCCGTCCGCGCCCGTCGCGGATCCCGGAGTCGCAGCGGCAGCGGCAGCTCTTCGGCCCCGGA
GCCGTCGTCGAGCAGCGCCGCTTCCGGGCGCCTCCGGGCAAGAAGATTTACGTGCCGGTCCGGGTCGAGCCCAAG
GTCTACTTTGCCGCCGAGCGGACCTTTCTCGGATGGCTCGAGTACTCCATCTACGTAGGCGCCATCGCAGTCACC
CTCCTCAACTTCGGCACCCGCACCTCGTCCCTCTCCTTCTGGTCGGCCGCCGCCTTTACCCTGCTGGCGCTGCTG
AGCCTGTCCTACTCGGTCGTCGTCTATTTGTATCGAAGCCGGGCGATTCGGAGCCGGCGGGCGGCGCGGTACTAT
GATCGCTGGGGGCCTTCGGTCCTGTGCGGAGCGCTGTTTGCGGCCGTTGCTGTGAATTTTGTGCTCGAGGGGAGG
CAGAGGGGGTTGCTGTGA
Gene >Ophcf2|00325
ATGAAGTTCGGCGAGCAGCTGCGTTCCAGCGTCATCCGCGAGTATCAATGGTACTACATCGACTACAACGGCCTC
AAGGCCGAGCTCAAGACGGCCAAAGTCGGCGGTCGCGAATGGACAGAGGACGACGAGACGCGCTTCGTCGGCAAG
CTCGAGGACGAGCTGGAAAAGGTGCACACCAAGCAGCAGGTCAAGGCCATGGAGATCTCGCGCCGCATAGCAGTC
AGCGAGCGAGAGGTTCGCGACGTCGTCGGCCGCCTCAATGATCGCGGACTGGGCGATCAAGGGCCCTGCGAGGAA
GAGTTTGTCCTGCTGGAAGAGGACCTGGGCGACATCATCGCAGAGGTCCACGACCTGGCCAAGTTTGTCCAGCTC
AACTATACCGGATTCTATAAGATAATCAAGAAGCACGACGTGAGCTCTCTCTGTTTCACTTGTCGCTCCCCTGGC
TCCCCTTGCTCCCCTTGCTTCTTTCTGACTGAGCCCGTCCGTCGTCGACCAACAGAAAATGACGGGTTGGCACCT
CCGGCCGGCCTTTGACACGCGCCTCAAGGCGAAGCCCTTCTACAAGGAAAACTACGACACGTCCGTCATCAAGCT
CTCGACGCTCTACGACCTCGTCCGCACCCGAGGCAACCCCGTCCAGGGCGACAGCGCCGCCGGAGGCTCCCAGGC
CAGCTTCGTCAGGCAGACGACCAAGTACTGGGTCCATCCCGACAACGTGACGGAGCTCAAGCTCATCATCCTCAA
GCACCTGCCCGTCCTCGTCTTCAACGCGGCCAAGGCCTTTGAGCAGCAAGACTCGGCCATCACCTCCATCTACTT
CGACAACCCGGACACGTGGGACCTCTACGAGGGCCGACTCAAGAAGACCGAGGGCGCCGAGGCCATCCGACTACG
CTGGTACGGAGGCATGAAGACAGAGACCGTCTTCGTCGAGCGCAAGACGCACCGCGAGGACTGGACCGGCGAGAA
GTCGGTCAAGGCCCGCTTCTCCGTCAAGGAGAAGAACGTCAACGCCTACCTGAGCGGCGAGCTGCTGCCGACGGC
CCTCTTCGACAAGGCCCGCAGGGAGGGCCGCAAGTCGGAAAAGGCCATTGCCGAGGACGAGAGGCTGGCGTCGGA
GATCCAGTACGCCGTGCTCAAGAGGGGCTACCGGCCCGTCTGCCGCTCCTTTTATAACCGGACCGCCTTCCAGCT
GCCGGCCGACGCCCGAGTCCGCATCTCGCTCGATACCGAGCTGACCATGATGCGAGAGGACAACCTCGACGGCCG
TCGGCGCTGCGGCGACAACTGGCGCCGCATGGACATTGGCATCGACTATCCCTTTGCCCAGCTGCCTCCCGACGA
CGTGGTCCGCTTCCCCTACGCCGTGCTCGAGGTTAAGTTGCAGACGCAGCTGGGACAAGAGCCGCCGGCGTGGGT
TCGTCAGCTCATCTCGTCTCACCTGGTCGAGGCCGTTCCCAAGTTCTCCAAGTTTATCCACGGAGCCGCCTGTCT
GTTCCCGGACCGCATCCATCTTCTGCCCTTTTGGATGCCTCAGATGGACGTCGACATCCGGAAGCCAGTCACCCA
CGACTTTGGCATCCGTCGGAGGCCAGGAACCGCCGGCACCACCACGTCGTCCGAGGACGAGGAGGACCTTGACTC
GGATGACGGCGCTGGGCACGACGATGACGGCCCTCGACAGCAGCCGGTCAACGACGCCGAGGGTCAGACTGCCGA
TGACGCCCACCAAGGCGCCGCCGACTTTCCCATTTACGATTCGGACGACGAGTACGACGAGAACTACGAGCTCGA
CGAGGCACGACGACTGGGCGGTCGCCGCTACTACTCGGCCCTCGTGACGGCAAAGGCCCGTTCCCTCGCCCGAGG
CGCCCTCTCCGTCGTCAAGGCCGTCGCTCCCCGTCCGCGCCCGTCGCGGATCCCGGAGTCGCAGCGGCAGCGGCA
GCTCTTCGGCCCCGGAGCCGTCGTCGAGCAGCGCCGCTTCCGGGCGCCTCCGGGCAAGAAGATTTACGTGCCGGT
CCGGGTCGAGCCCAAGGTCTACTTTGCCGCCGAGCGGACCTTTCTCGGATGGGTGAGTTCTCCTCTTCCCCCCCC
CCTCGAACCCCCATCCCGTTCGTCGAGGACGAAAAAAGGAGGCCAGACTGACGGACATCCGTTTCCCCCCCAGCT
CGAGTACTCCATCTACGTAGGCGCCATCGCAGTCACCCTCCTCAACTTCGGCACCCGCACCTCGTCCCTCTCCTT
CTGGTCGGCCGCCGCCTTTACCCTGCTGGCGCTGCTGAGCCTGTCCTACTCGGTCGTCGTCTATTTGTATCGAAG
CCGGGCGATTCGGAGCCGGCGGGCGGCGCGGTACTATGATCGCTGGGGGCCTTCGGTCCTGTGCGGAGCGCTGTT
TGCGGCCGTTGCTGTGAATTTTGTGCTCGAGGGGAGGCAGAGGGGGTTGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail