Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00309
Gene name
Locationscaffold_01:1442728..1443692
Strand+
Gene length (bp)964
Transcript length (bp)828
Coding sequence length (bp)828
Protein length (aa) 276

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.0903 0.0903 0.7889 0.5154 0.0756 0.0033 0.239 0.0792 0.1347 0.0037

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999678

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup854
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6674
Ophiocordyceps australis map64 (Brazil) OphauB2|4345
Ophiocordyceps camponoti-floridani Ophcf2|00309 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1838
Ophiocordyceps camponoti-rufipedis Ophun1|2514
Ophiocordyceps kimflemingae Ophio5|1373
Ophiocordyceps subramaniannii Hirsu2|4665

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00309
MKSTIAISLLAAATVQAGENYDAASSRPTLLNSDYNNVRPGQDFNLQFSGCESGCTVTVKQGQAENLQDLKNTPS
FPVSGTSGTIKIPEGVDAKKVALVITDNKGNVNYSPQFDLQGAGAAPAPAPAPVPTSAPADNKNNDDKNKTDDNK
DKNNNDDKDKDKNDDEKNKTEGSKNKNENSSAARDASPATTTPASIDDASSTTTTAASPDATTSGSSSSTTLTSG
TRGATRTTTSSSSTRTAQSSTTRVPGSSGVGRNAVPWILSGVMAVVALIN*
Coding >Ophcf2|00309
ATGAAGTCGACCATCGCCATCTCCCTCCTCGCCGCCGCCACCGTCCAGGCTGGCGAGAACTATGACGCCGCCAGC
TCGCGTCCTACACTCCTCAACAGCGACTACAACAACGTGAGGCCGGGTCAGGACTTCAACTTGCAGTTCAGCGGC
TGCGAGAGCGGCTGTACCGTTACCGTCAAGCAGGGTCAAGCCGAGAACCTGCAGGACCTCAAGAACACCCCCAGC
TTCCCCGTCAGCGGCACGTCCGGCACCATCAAGATCCCCGAGGGCGTCGACGCGAAGAAGGTGGCCCTCGTCATC
ACCGATAACAAGGGCAACGTCAACTACAGCCCGCAGTTTGACCTCCAGGGCGCCGGTGCTGCCCCCGCTCCCGCT
CCCGCGCCTGTCCCTACCTCTGCCCCTGCAGACAACAAGAACAACGATGACAAGAACAAGACGGATGACAACAAG
GATAAGAACAACAACGATGACAAGGACAAGGACAAGAACGACGACGAAAAGAACAAGACGGAAGGCAGCAAGAAC
AAGAACGAGAACAGCTCCGCCGCCCGCGATGCTTCCCCCGCCACGACCACGCCCGCATCCATCGACGACGCCAGC
TCAACCACCACCACAGCCGCCTCCCCCGATGCCACCACCAGCGGCTCATCTTCGTCAACGACGCTCACCTCCGGA
ACCCGCGGCGCGACCCGCACCACCACCTCGTCCTCGTCTACTCGCACAGCTCAGTCGTCGACGACACGCGTCCCC
GGCTCCTCGGGCGTCGGCCGCAACGCCGTCCCCTGGATCCTTTCGGGCGTCATGGCCGTCGTGGCTCTCATCAAC
TGA
Transcript >Ophcf2|00309
ATGAAGTCGACCATCGCCATCTCCCTCCTCGCCGCCGCCACCGTCCAGGCTGGCGAGAACTATGACGCCGCCAGC
TCGCGTCCTACACTCCTCAACAGCGACTACAACAACGTGAGGCCGGGTCAGGACTTCAACTTGCAGTTCAGCGGC
TGCGAGAGCGGCTGTACCGTTACCGTCAAGCAGGGTCAAGCCGAGAACCTGCAGGACCTCAAGAACACCCCCAGC
TTCCCCGTCAGCGGCACGTCCGGCACCATCAAGATCCCCGAGGGCGTCGACGCGAAGAAGGTGGCCCTCGTCATC
ACCGATAACAAGGGCAACGTCAACTACAGCCCGCAGTTTGACCTCCAGGGCGCCGGTGCTGCCCCCGCTCCCGCT
CCCGCGCCTGTCCCTACCTCTGCCCCTGCAGACAACAAGAACAACGATGACAAGAACAAGACGGATGACAACAAG
GATAAGAACAACAACGATGACAAGGACAAGGACAAGAACGACGACGAAAAGAACAAGACGGAAGGCAGCAAGAAC
AAGAACGAGAACAGCTCCGCCGCCCGCGATGCTTCCCCCGCCACGACCACGCCCGCATCCATCGACGACGCCAGC
TCAACCACCACCACAGCCGCCTCCCCCGATGCCACCACCAGCGGCTCATCTTCGTCAACGACGCTCACCTCCGGA
ACCCGCGGCGCGACCCGCACCACCACCTCGTCCTCGTCTACTCGCACAGCTCAGTCGTCGACGACACGCGTCCCC
GGCTCCTCGGGCGTCGGCCGCAACGCCGTCCCCTGGATCCTTTCGGGCGTCATGGCCGTCGTGGCTCTCATCAAC
TGA
Gene >Ophcf2|00309
ATGAAGTCGACCATCGCCATCTCCCTCCTCGCCGCCGCCACCGTCCAGGCTGGCGAGAACTATGACGCCGCCAGC
TCGCGTCCTACACTCCTCAACAGCGACTACAACAACGTGAGGCCGGGTCAGGACTTCAACTTGCAGTTCAGCGGC
TGCGAGAGCGGCTGTACCGTTACCGTCAAGCAGGGTCAAGCCGAGAACCTGCAGGACCTCAAGAACACCCCCAGC
TGTGCGTCTTACTTGATTTAATACTCTTGCTCTTCACTGCCTCTTTTGCTGTTGTGTTGACCTTGTTCAGTCCCC
GTCAGCGGCACGTCCGGCACCATCAAGATCCCCGAGGGCGTCGACGCGAAGAAGGTGGCCCTCGTCATCACCGAT
AACAAGGGCAACGTCAACTACAGCCCGCAGTTTGACCTCCAGGGCGCCGGTGCTGCCCCCGCTCCCGCTCCCGCG
CCTGTCCCTACCTCTGCCCCTGCAGACAACAAGAACAACGATGACAAGAACAAGACGGATGACAACAAGGATAAG
AACAACAACGATGACAAGGACAAGGACAAGAACGACGACGAAAAGAACAAGACGGAAGGCAGCAAGAACAAGAAC
GAGAACAGCTCCGCCGCCCGCGATGCTTCCCCCGCCACGACCACGCCCGCATCCATCGACGACGCCAGCTCAACC
ACCACCACAGCCGCCTCCCCCGATGCCACCACCAGCGGCTCATCTTCGTCAACGACGCTCACCTCCGGAACCCGC
GGCGCGACCCGCACCACCACCTCGTGTAAGTCACTGCATCCACGCTACCTCCTCGCTACAGCAAGCTGACAATGG
CACCCCTATACGCGCAGCCTCGTCTACTCGCACAGCTCAGTCGTCGACGACACGCGTCCCCGGCTCCTCGGGCGT
CGGCCGCAACGCCGTCCCCTGGATCCTTTCGGGCGTCATGGCCGTCGTGGCTCTCATCAACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail