Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00304
Gene name
Locationscaffold_01:1426083..1427714
Strand-
Gene length (bp)1631
Transcript length (bp)1410
Coding sequence length (bp)1410
Protein length (aa) 470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 3.2E-36 157 433

GO

GO Term Description Terminal node
GO:0071704 organic substance metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 55 77 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 25.23 12.86 37.59
Alive In ants, during behavior modification 18.87 8.80 28.94
Dead In ants, recently dead 25.77 13.14 38.40

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.215087 no
Alive Dead 0.105395 no
Dead Fungus 0.939503 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00304
MAPASPSRRHWTAPPLRIINYGTWVKVKGYRQLPLFQRPRSKRVRTLQRLRRWQLSPCRMMLVILAIFFLALAAY
IWRKEARLSAPWIPDAESELFSKGPLAPPQQSSNISQFQLPLKTRGRAIVDQTGRRFKLSSVNWYGASDELFVVG
GLDVQHRDVIAQTILRLGFNSVRLPYSDELVMKNPVIESRLVSANPDLAGKRALDVIEAVVTALTEAGIAVVVNN
HITTATWCCGIDPCDSGWSNHHLGLLCRVGQTEEQWIHHWEKLMARFVDNPRVIGADLRNEVRGLWGTMPWSRWA
SAAERCGNRLLEMRPDWLIFVEGTESANDVSGARDRPVRLDVADRLVYSAHVYAWSGWGSWEGRFAQRDYDSFAA
AMRRNWAYLVDEDVAPVWVGELGAPNNPTNGDAHYWKNLWRFLKEVDADFGYWAINPRKPKDNGSESYSIVADDW
VTPVLDYRLKEMVDLMHSS*
Coding >Ophcf2|00304
ATGGCCCCCGCAAGCCCTTCCCGACGGCATTGGACGGCACCGCCCCTCCGCATCATCAACTACGGCACCTGGGTA
AAAGTCAAGGGCTACCGCCAGCTACCGCTCTTCCAGCGACCGCGGTCCAAGCGGGTGCGGACGCTGCAGCGGCTG
CGAAGGTGGCAGCTTTCGCCCTGCAGGATGATGCTCGTCATCCTCGCCATCTTCTTCCTAGCCTTGGCCGCATAC
ATCTGGCGGAAAGAGGCTCGACTATCAGCCCCGTGGATCCCCGATGCCGAATCCGAGCTCTTCAGTAAAGGCCCC
CTGGCACCTCCCCAGCAGAGCAGCAACATATCTCAATTCCAACTACCGCTCAAGACGCGCGGGAGAGCCATCGTC
GATCAGACGGGGCGACGCTTTAAGCTCTCGTCGGTGAATTGGTACGGTGCGAGCGATGAGCTCTTCGTCGTGGGC
GGTCTCGATGTTCAACACCGAGACGTCATCGCCCAGACCATCCTCCGCCTCGGTTTCAACAGCGTCCGTCTCCCT
TACTCGGACGAGCTGGTGATGAAGAACCCCGTGATAGAGAGCCGACTCGTCAGCGCCAACCCGGATCTCGCGGGG
AAGCGCGCCCTCGACGTGATCGAAGCCGTCGTGACGGCCCTGACGGAGGCGGGCATCGCCGTCGTCGTCAACAAT
CACATCACGACGGCGACGTGGTGCTGCGGCATCGACCCTTGCGACTCGGGCTGGTCCAACCATCATCTCGGTCTG
CTGTGTCGCGTCGGACAGACGGAAGAGCAATGGATTCATCACTGGGAGAAACTCATGGCCCGCTTCGTCGATAAC
CCTCGCGTCATCGGCGCCGACCTCCGCAACGAGGTCCGCGGCCTCTGGGGAACCATGCCGTGGTCTCGCTGGGCC
TCGGCCGCCGAACGCTGCGGGAACCGTCTCCTCGAGATGCGTCCGGACTGGCTCATCTTCGTCGAGGGCACCGAA
TCGGCAAACGACGTATCCGGAGCCCGAGACCGTCCCGTCCGCCTCGACGTGGCCGACCGTCTCGTCTACTCGGCT
CACGTCTACGCCTGGTCCGGCTGGGGAAGTTGGGAGGGCCGCTTCGCCCAGCGTGACTACGACTCCTTCGCCGCC
GCCATGCGCCGCAACTGGGCCTACCTCGTCGACGAGGACGTCGCGCCCGTCTGGGTGGGAGAGCTGGGCGCGCCC
AACAACCCTACCAACGGCGACGCCCATTACTGGAAGAACCTGTGGCGCTTCCTCAAAGAGGTCGACGCCGACTTT
GGCTACTGGGCCATCAACCCTCGCAAGCCCAAGGATAACGGCTCCGAGTCGTACTCCATCGTGGCTGATGATTGG
GTCACGCCCGTGCTGGACTACCGACTCAAGGAGATGGTCGACCTGATGCACTCTTCTTGA
Transcript >Ophcf2|00304
ATGGCCCCCGCAAGCCCTTCCCGACGGCATTGGACGGCACCGCCCCTCCGCATCATCAACTACGGCACCTGGGTA
AAAGTCAAGGGCTACCGCCAGCTACCGCTCTTCCAGCGACCGCGGTCCAAGCGGGTGCGGACGCTGCAGCGGCTG
CGAAGGTGGCAGCTTTCGCCCTGCAGGATGATGCTCGTCATCCTCGCCATCTTCTTCCTAGCCTTGGCCGCATAC
ATCTGGCGGAAAGAGGCTCGACTATCAGCCCCGTGGATCCCCGATGCCGAATCCGAGCTCTTCAGTAAAGGCCCC
CTGGCACCTCCCCAGCAGAGCAGCAACATATCTCAATTCCAACTACCGCTCAAGACGCGCGGGAGAGCCATCGTC
GATCAGACGGGGCGACGCTTTAAGCTCTCGTCGGTGAATTGGTACGGTGCGAGCGATGAGCTCTTCGTCGTGGGC
GGTCTCGATGTTCAACACCGAGACGTCATCGCCCAGACCATCCTCCGCCTCGGTTTCAACAGCGTCCGTCTCCCT
TACTCGGACGAGCTGGTGATGAAGAACCCCGTGATAGAGAGCCGACTCGTCAGCGCCAACCCGGATCTCGCGGGG
AAGCGCGCCCTCGACGTGATCGAAGCCGTCGTGACGGCCCTGACGGAGGCGGGCATCGCCGTCGTCGTCAACAAT
CACATCACGACGGCGACGTGGTGCTGCGGCATCGACCCTTGCGACTCGGGCTGGTCCAACCATCATCTCGGTCTG
CTGTGTCGCGTCGGACAGACGGAAGAGCAATGGATTCATCACTGGGAGAAACTCATGGCCCGCTTCGTCGATAAC
CCTCGCGTCATCGGCGCCGACCTCCGCAACGAGGTCCGCGGCCTCTGGGGAACCATGCCGTGGTCTCGCTGGGCC
TCGGCCGCCGAACGCTGCGGGAACCGTCTCCTCGAGATGCGTCCGGACTGGCTCATCTTCGTCGAGGGCACCGAA
TCGGCAAACGACGTATCCGGAGCCCGAGACCGTCCCGTCCGCCTCGACGTGGCCGACCGTCTCGTCTACTCGGCT
CACGTCTACGCCTGGTCCGGCTGGGGAAGTTGGGAGGGCCGCTTCGCCCAGCGTGACTACGACTCCTTCGCCGCC
GCCATGCGCCGCAACTGGGCCTACCTCGTCGACGAGGACGTCGCGCCCGTCTGGGTGGGAGAGCTGGGCGCGCCC
AACAACCCTACCAACGGCGACGCCCATTACTGGAAGAACCTGTGGCGCTTCCTCAAAGAGGTCGACGCCGACTTT
GGCTACTGGGCCATCAACCCTCGCAAGCCCAAGGATAACGGCTCCGAGTCGTACTCCATCGTGGCTGATGATTGG
GTCACGCCCGTGCTGGACTACCGACTCAAGGAGATGGTCGACCTGATGCACTCTTCTTGA
Gene >Ophcf2|00304
ATGGCCCCCGCAAGCCCTTCCCGTCAGCGACCCCCCCTCCCCTGGAGGACCTAAAGGAAGACCCCTTGGAAAGCT
TCCTCGCCTGGCCGCCCAGCCCGAGCGAGCCGGAAACTGCCCTGAGGAGCCACCCACTGAAGGGCCAGCTGGGGT
CGTCGGCCCCGGAAGATGCGGTGCTACCCCTCCCCGGGCCACCCGCATCACCGCTATCATCATCGTCATCATCAC
CACCACCACCACAACCAGGACGGCATTGGACGGCACCGCCCCTCCGCATCATCAACTACGGCACCTGGGTAAAAG
TCAAGGGCTACCGCCAGCTACCGCTCTTCCAGCGACCGCGGTCCAAGCGGGTGCGGACGCTGCAGCGGCTGCGAA
GGTGGCAGCTTTCGCCCTGCAGGATGATGCTCGTCATCCTCGCCATCTTCTTCCTAGCCTTGGCCGCATACATCT
GGCGGAAAGAGGCTCGACTATCAGCCCCGTGGATCCCCGATGCCGAATCCGAGCTCTTCAGTAAAGGCCCCCTGG
CACCTCCCCAGCAGAGCAGCAACATATCTCAATTCCAACTACCGCTCAAGACGCGCGGGAGAGCCATCGTCGATC
AGACGGGGCGACGCTTTAAGCTCTCGTCGGTGAATTGGTACGGTGCGAGCGATGAGCTCTTCGTCGTGGGCGGTC
TCGATGTTCAACACCGAGACGTCATCGCCCAGACCATCCTCCGCCTCGGTTTCAACAGCGTCCGTCTCCCTTACT
CGGACGAGCTGGTGATGAAGAACCCCGTGATAGAGAGCCGACTCGTCAGCGCCAACCCGGATCTCGCGGGGAAGC
GCGCCCTCGACGTGATCGAAGCCGTCGTGACGGCCCTGACGGAGGCGGGCATCGCCGTCGTCGTCAACAATCACA
TCACGACGGCGACGTGGTGCTGCGGCATCGACCCTTGCGACTCGGGCTGGTCCAACCATCATCTCGGTCTGCTGT
GTCGCGTCGGACAGACGGAAGAGCAATGGATTCATCACTGGGAGAAACTCATGGCCCGCTTCGTCGATAACCCTC
GCGTCATCGGCGCCGACCTCCGCAACGAGGTCCGCGGCCTCTGGGGAACCATGCCGTGGTCTCGCTGGGCCTCGG
CCGCCGAACGCTGCGGGAACCGTCTCCTCGAGATGCGTCCGGACTGGCTCATCTTCGTCGAGGGCACCGAATCGG
CAAACGACGTATCCGGAGCCCGAGACCGTCCCGTCCGCCTCGACGTGGCCGACCGTCTCGTCTACTCGGCTCACG
TCTACGCCTGGTCCGGCTGGGGAAGTTGGGAGGGCCGCTTCGCCCAGCGTGACTACGACTCCTTCGCCGCCGCCA
TGCGCCGCAACTGGGCCTACCTCGTCGACGAGGACGTCGCGCCCGTCTGGGTGGGAGAGCTGGGCGCGCCCAACA
ACCCTACCAACGGCGACGCCCATTACTGGAAGAACCTGTGGCGCTTCCTCAAAGAGGTCGACGCCGACTTTGGCT
ACTGGGCCATCAACCCTCGCAAGCCCAAGGATAACGGCTCCGAGTCGTACTCCATCGTGGCTGATGATTGGGTCA
CGCCCGTGCTGGACTACCGACTCAAGGAGATGGTCGACCTGATGCACTCTTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail