Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00302
Gene name
Locationscaffold_01:1419578..1421247
Strand-
Gene length (bp)1669
Transcript length (bp)1521
Coding sequence length (bp)1521
Protein length (aa) 507

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00909 Ammonium_transp Ammonium Transporter Family 2.4E-115 38 443

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0072488 ammonium transmembrane transport Yes
GO:0008519 ammonium transmembrane transporter activity Yes
GO:0098662 inorganic cation transmembrane transport No
GO:0051234 establishment of localization No
GO:0015267 channel activity No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0098655 cation transmembrane transport No
GO:0034220 ion transmembrane transport No
GO:0006812 cation transport No
GO:0008324 cation transmembrane transporter activity No
GO:0022803 passive transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0098660 inorganic ion transmembrane transport No
GO:0071705 nitrogen compound transport No
GO:0015075 ion transmembrane transporter activity No
GO:0005261 cation channel activity No
GO:0055085 transmembrane transport No
GO:0006811 ion transport No
GO:0008150 biological_process No
GO:0051179 localization No
GO:0005216 ion channel activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.5

Transmembrane Domains

Domain # Start End Length
1 38 60 22
2 67 89 22
3 128 150 22
4 155 177 22
5 192 214 22
6 227 246 19
7 256 278 22
8 290 309 19
9 313 330 17
10 351 373 22
11 388 410 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00302
MSYSQVGPPVAFNGSESGLGGDATTTNLNQWYRSGDQAFILICSCLVLLMIPGVAFLYSGLARRKSALSMLWVVV
MSLSVIVFQWYFWGFSLAFSQSSTNAFIGDVSLVGLRGVLARPSQGSPLLPALLYALYQMMFCAVTAAITVGAVA
ERGRVVPAMVFIFVWATLVYCPLAYWVWNANGWAMRRGVLDYAGGVPVEIGSGVSALAYSWVLGRRNDKLMANFR
PHNVSLIGLGTVLLWIGWLGFNAGSSFGANLRAVMACWNSCLAASFAAMTWCLLDYRLTKKWSMVGWCSGAISGL
VAATPASGFIDPWASILMGLVSGVACNFGTKIKHIARIDDALDIFAEHAIGGIVGLVFNGFFATGRVIGLDGINT
GATGGFLDHKFSLLGWQLVVIAAASAYTFVVAAAIAKAIDIIPGLHLRASDDAELLGMDDNQHGEFSYDYVEVRR
DFLAWSPQSDAPATDGDVFMPQHGIPLHADVARPSEADRTEKSSPASSSQADAGNP*
Coding >Ophcf2|00302
ATGTCTTACAGCCAGGTCGGGCCGCCCGTCGCCTTCAACGGGTCTGAGTCCGGGCTCGGTGGCGATGCCACTACC
ACGAACCTCAACCAGTGGTATCGGTCCGGAGATCAGGCCTTCATCCTGATATGCTCCTGTCTCGTGCTCCTCATG
ATCCCCGGCGTCGCCTTTCTGTACTCGGGCCTCGCCCGCCGCAAGTCTGCACTCTCCATGCTCTGGGTCGTCGTC
ATGTCCCTGTCCGTCATCGTCTTTCAGTGGTACTTCTGGGGCTTCTCCCTCGCCTTCAGCCAGTCATCGACCAAC
GCCTTCATCGGTGACGTCTCCTTGGTCGGCCTCAGGGGCGTCCTGGCTCGTCCCTCGCAGGGCTCGCCATTGCTG
CCGGCCCTGCTGTACGCCCTGTATCAGATGATGTTCTGCGCCGTCACCGCCGCCATCACCGTCGGCGCCGTCGCC
GAGCGCGGACGCGTCGTTCCCGCCATGGTCTTCATCTTCGTCTGGGCCACCCTCGTCTACTGCCCGCTGGCTTAT
TGGGTCTGGAACGCAAACGGATGGGCCATGAGGCGAGGCGTCCTCGATTATGCCGGTGGCGTCCCCGTCGAGATC
GGCTCCGGCGTCTCAGCCCTGGCCTATTCGTGGGTCCTGGGCCGTCGCAACGACAAGCTCATGGCCAACTTCCGG
CCTCACAACGTGTCCCTCATCGGCCTCGGCACCGTCCTGCTGTGGATCGGCTGGCTGGGCTTCAACGCCGGCTCC
TCCTTTGGCGCCAACCTCCGGGCCGTCATGGCCTGCTGGAACTCGTGTCTGGCGGCCTCCTTTGCCGCCATGACC
TGGTGTCTGCTCGACTATCGACTGACCAAGAAGTGGTCCATGGTCGGCTGGTGCTCCGGCGCCATCTCCGGCCTG
GTCGCCGCCACCCCGGCCTCGGGCTTCATCGACCCCTGGGCCAGCATCCTCATGGGCCTCGTCTCCGGCGTCGCC
TGCAACTTTGGAACCAAGATCAAACATATCGCACGCATCGACGACGCCCTCGACATCTTTGCCGAGCACGCCATC
GGTGGCATCGTCGGCCTCGTCTTCAACGGCTTCTTCGCCACCGGTCGCGTCATCGGCCTCGACGGCATCAACACG
GGCGCCACCGGTGGCTTCCTCGACCATAAATTCTCCCTCTTAGGCTGGCAGCTGGTCGTCATCGCCGCCGCCAGC
GCCTACACCTTCGTCGTGGCCGCCGCCATCGCAAAGGCCATAGACATCATACCGGGACTCCATCTGCGCGCCTCC
GATGACGCGGAGCTCCTCGGAATGGACGACAACCAGCACGGCGAGTTCTCGTACGACTACGTCGAGGTCCGTCGA
GACTTTCTCGCCTGGAGTCCGCAGAGTGACGCTCCCGCTACCGATGGCGACGTCTTTATGCCTCAGCATGGCATC
CCGCTTCACGCTGACGTGGCCCGCCCGTCTGAGGCTGATCGGACGGAGAAGTCGTCGCCAGCTTCGTCATCGCAA
GCCGATGCTGGCAATCCATGA
Transcript >Ophcf2|00302
ATGTCTTACAGCCAGGTCGGGCCGCCCGTCGCCTTCAACGGGTCTGAGTCCGGGCTCGGTGGCGATGCCACTACC
ACGAACCTCAACCAGTGGTATCGGTCCGGAGATCAGGCCTTCATCCTGATATGCTCCTGTCTCGTGCTCCTCATG
ATCCCCGGCGTCGCCTTTCTGTACTCGGGCCTCGCCCGCCGCAAGTCTGCACTCTCCATGCTCTGGGTCGTCGTC
ATGTCCCTGTCCGTCATCGTCTTTCAGTGGTACTTCTGGGGCTTCTCCCTCGCCTTCAGCCAGTCATCGACCAAC
GCCTTCATCGGTGACGTCTCCTTGGTCGGCCTCAGGGGCGTCCTGGCTCGTCCCTCGCAGGGCTCGCCATTGCTG
CCGGCCCTGCTGTACGCCCTGTATCAGATGATGTTCTGCGCCGTCACCGCCGCCATCACCGTCGGCGCCGTCGCC
GAGCGCGGACGCGTCGTTCCCGCCATGGTCTTCATCTTCGTCTGGGCCACCCTCGTCTACTGCCCGCTGGCTTAT
TGGGTCTGGAACGCAAACGGATGGGCCATGAGGCGAGGCGTCCTCGATTATGCCGGTGGCGTCCCCGTCGAGATC
GGCTCCGGCGTCTCAGCCCTGGCCTATTCGTGGGTCCTGGGCCGTCGCAACGACAAGCTCATGGCCAACTTCCGG
CCTCACAACGTGTCCCTCATCGGCCTCGGCACCGTCCTGCTGTGGATCGGCTGGCTGGGCTTCAACGCCGGCTCC
TCCTTTGGCGCCAACCTCCGGGCCGTCATGGCCTGCTGGAACTCGTGTCTGGCGGCCTCCTTTGCCGCCATGACC
TGGTGTCTGCTCGACTATCGACTGACCAAGAAGTGGTCCATGGTCGGCTGGTGCTCCGGCGCCATCTCCGGCCTG
GTCGCCGCCACCCCGGCCTCGGGCTTCATCGACCCCTGGGCCAGCATCCTCATGGGCCTCGTCTCCGGCGTCGCC
TGCAACTTTGGAACCAAGATCAAACATATCGCACGCATCGACGACGCCCTCGACATCTTTGCCGAGCACGCCATC
GGTGGCATCGTCGGCCTCGTCTTCAACGGCTTCTTCGCCACCGGTCGCGTCATCGGCCTCGACGGCATCAACACG
GGCGCCACCGGTGGCTTCCTCGACCATAAATTCTCCCTCTTAGGCTGGCAGCTGGTCGTCATCGCCGCCGCCAGC
GCCTACACCTTCGTCGTGGCCGCCGCCATCGCAAAGGCCATAGACATCATACCGGGACTCCATCTGCGCGCCTCC
GATGACGCGGAGCTCCTCGGAATGGACGACAACCAGCACGGCGAGTTCTCGTACGACTACGTCGAGGTCCGTCGA
GACTTTCTCGCCTGGAGTCCGCAGAGTGACGCTCCCGCTACCGATGGCGACGTCTTTATGCCTCAGCATGGCATC
CCGCTTCACGCTGACGTGGCCCGCCCGTCTGAGGCTGATCGGACGGAGAAGTCGTCGCCAGCTTCGTCATCGCAA
GCCGATGCTGGCAATCCATGA
Gene >Ophcf2|00302
ATGTCTTACAGCCAGGTCGGGCCGCCCGTCGCCTTCAACGGGTCTGAGTCCGGGCTCGGTGGCGATGCCAGTATG
CTATGCTTCCTCCGTCCACCGGGATCCCTCCCCTTTGGTTTCGAAGAGTGGCCCGTGGGACTGACCACCTCGTCC
TGTCACAGCTACCACGAACCTCAACCAGTGGTATCGGTCCGGAGATCAGGCCTTCATCCTGATATGCTCCTGTCT
CGTGCTCCTCATGATCCCCGGCGTCGCCTTTCTGTACTCGGGCCTCGCCCGCCGCAAGTCTGCACTCTCCATGCT
CTGGGTCGTCGTCATGTCCCTGTCCGTCATCGTCTTTCAGTGGTACTTCTGGGGCTTCTCCCTCGCCTTCAGCCA
GTCATCGACCAACGCCTTCATCGGTGACGTCTCCTTGGTCGGCCTCAGGGGCGTCCTGGCTCGTCCCTCGCAGGG
CTCGCCATTGCTGCCGGCCCTGCTGTACGCCCTGTATCAGATGATGTTCTGCGCCGTCACCGCCGCCATCACCGT
CGGCGCCGTCGCCGAGCGCGGACGCGTCGTTCCCGCCATGGTCTTCATCTTCGTCTGGGCCACCCTCGTCTACTG
CCCGCTGGCTTATTGGGTCTGGAACGCAAACGGATGGGCCATGAGGCGAGGCGTCCTCGATTATGCCGGTGGCGT
CCCCGTCGAGATCGGCTCCGGCGTCTCAGCCCTGGCCTATTCGTGGGTCCTGGGCCGTCGCAACGACAAGCTCAT
GGCCAACTTCCGGCCTCACAACGTGTCCCTCATCGGCCTCGGCACCGTCCTGCTGTGGATCGGCTGGCTGGGCTT
CAACGCCGGCTCCTCCTTTGGCGCCAACCTCCGGGCCGTCATGGCCTGCTGGAACTCGTGTCTGGCGGCCTCCTT
TGCCGCCATGACCTGGTGTCTGCTCGACTATCGACTGACCAAGAAGTGGTCCATGGTCGGCTGGTGCTCCGGCGC
CATCTCCGGCCTGGTCGCCGCCACCCCGGCCTCGGGCTTCATCGACCCCTGGGCCAGCATCCTCATGGGCCTCGT
CTCCGGCGTCGCCTGCAACTTTGGAACCAAGAGTCCGTTCCCCCTGCTGGCCCCCCGGGAGGTAGCGGTCCGTCA
CTGACAAGTCGGCCCAGTCAAACATATCGCACGCATCGACGACGCCCTCGACATCTTTGCCGAGCACGCCATCGG
TGGCATCGTCGGCCTCGTCTTCAACGGCTTCTTCGCCACCGGTCGCGTCATCGGCCTCGACGGCATCAACACGGG
CGCCACCGGTGGCTTCCTCGACCATAAATTCTCCCTCTTAGGCTGGCAGCTGGTCGTCATCGCCGCCGCCAGCGC
CTACACCTTCGTCGTGGCCGCCGCCATCGCAAAGGCCATAGACATCATACCGGGACTCCATCTGCGCGCCTCCGA
TGACGCGGAGCTCCTCGGAATGGACGACAACCAGCACGGCGAGTTCTCGTACGACTACGTCGAGGTCCGTCGAGA
CTTTCTCGCCTGGAGTCCGCAGAGTGACGCTCCCGCTACCGATGGCGACGTCTTTATGCCTCAGCATGGCATCCC
GCTTCACGCTGACGTGGCCCGCCCGTCTGAGGCTGATCGGACGGAGAAGTCGTCGCCAGCTTCGTCATCGCAAGC
CGATGCTGGCAATCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail