Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00301
Gene name
Locationscaffold_01:1417307..1419344
Strand+
Gene length (bp)2037
Transcript length (bp)1755
Coding sequence length (bp)1755
Protein length (aa) 585

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2) 6.4E-43 167 522

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 46 68 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 197.24 100.58 293.89
Alive In ants, during behavior modification 111.12 61.01 161.23
Dead In ants, recently dead 120.68 65.77 175.60

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.002793 yes
Alive Dead 0.681907 no
Dead Fungus 0.015811 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00301
MSQSNNVIKQGSVDYEPVHQDEEDPHSDRPAPLRRSSEAELRHLRFAVYLLAPCLAILAAFNIFQFWPSFESDGC
SHKRSKVPQYFQTSPELWAGPTATGKPPFLAETISWAPTQTYVPNEPLETSVPVEGMAPGDENIFHLMGHLSPYK
AAPGFGVEEYPLPEGAEIMQVQMLSRHGSRYPGTDSEVEQLAHRLGNASSSEFNTKGPLAFLKDWKYQLGLEILV
SNGRKELFNSGILHSYMYGAMYNTGSKIIARTTTQDRMLKSAENWLAGFFGLDWTKNATIEVIIDDTGFNNSLSG
ANNCPNAIPQTVGKAAAAVWMDKYLQNAVARFQNMTEGFNWTIQDVYAAQTMCPYETVALGSSKFCDLFTYEEWK
GYNYAVNLYFAGAAAFNSPTGRAMGLGYQQEMVARLQNHTLGYSGSQINVTLDNNTETFPLNQTLYFDFSHDTTI
VAALTAMGLVQFNESLPDTGPPPEQGWFVVSNMVPFGSRFDLEVIRTPKPVSAARDGYVEGGETRYVHLVLNQRT
VPLGKSFPECDAERKDGWCELGVFLKIQESMPAKAKFDYACFGHYPPVSYGEVKDGAPP*
Coding >Ophcf2|00301
ATGAGCCAGTCCAACAACGTCATCAAGCAGGGCTCCGTCGACTACGAGCCCGTCCATCAAGATGAGGAGGATCCT
CACTCGGACCGACCCGCCCCCCTGAGGAGGAGCTCCGAGGCGGAATTGCGCCATCTCAGATTCGCCGTCTACCTG
CTGGCCCCGTGCTTGGCCATCCTGGCCGCCTTCAACATCTTCCAGTTCTGGCCTTCATTCGAGTCGGATGGATGC
TCTCACAAGCGGTCCAAGGTGCCGCAGTACTTTCAGACGTCGCCAGAGCTATGGGCCGGACCGACGGCCACCGGC
AAGCCGCCCTTCTTGGCTGAAACCATCTCGTGGGCACCGACCCAGACCTACGTGCCCAACGAGCCGCTGGAGACG
TCGGTTCCCGTTGAGGGCATGGCACCCGGAGACGAGAACATCTTCCATCTCATGGGTCACTTGTCGCCGTATAAG
GCCGCGCCCGGCTTCGGCGTCGAAGAGTACCCTCTGCCCGAAGGTGCCGAAATCATGCAGGTTCAGATGCTCTCT
CGTCACGGATCCCGCTACCCCGGTACCGACTCCGAGGTCGAGCAGCTCGCCCACCGCCTAGGCAATGCTTCATCA
TCCGAATTCAATACAAAGGGCCCTCTAGCCTTTCTCAAAGACTGGAAGTACCAGCTCGGGCTCGAGATCCTCGTG
TCCAATGGCCGCAAGGAGCTCTTCAACTCGGGCATCTTGCACAGTTACATGTACGGGGCCATGTACAACACTGGT
AGCAAGATTATTGCTCGCACCACGACGCAAGATCGAATGCTCAAGTCGGCCGAGAACTGGCTGGCCGGCTTCTTC
GGCCTCGACTGGACCAAGAACGCCACCATCGAAGTCATCATTGATGACACCGGCTTCAACAACTCGCTCTCGGGC
GCCAACAATTGCCCCAATGCGATACCCCAGACGGTCGGCAAGGCTGCTGCGGCCGTCTGGATGGATAAGTATCTT
CAGAACGCCGTCGCTCGCTTCCAGAACATGACCGAGGGTTTCAACTGGACTATCCAAGACGTCTACGCTGCCCAG
ACGATGTGCCCTTATGAGACTGTCGCCCTCGGATCCAGCAAGTTCTGCGACTTGTTTACATACGAAGAATGGAAG
GGCTACAACTACGCCGTCAACCTGTACTTTGCCGGAGCGGCGGCTTTCAATAGTCCCACGGGTCGCGCCATGGGA
CTCGGCTATCAGCAGGAGATGGTGGCGCGGCTACAGAACCATACGCTCGGCTATTCCGGCTCGCAGATCAACGTG
ACGCTCGACAACAACACCGAGACCTTTCCGCTGAACCAGACGCTTTACTTTGACTTTTCCCACGACACCACCATC
GTCGCCGCCTTGACGGCCATGGGCCTCGTCCAGTTCAACGAGTCTCTTCCGGACACGGGCCCTCCTCCGGAGCAG
GGGTGGTTCGTAGTGTCCAACATGGTCCCATTCGGCTCCCGCTTCGACCTCGAGGTCATCAGGACGCCAAAGCCC
GTCTCTGCCGCCCGAGACGGCTACGTGGAAGGCGGCGAGACGCGTTACGTTCACCTGGTACTGAACCAGCGCACC
GTGCCCCTGGGCAAGAGCTTCCCCGAGTGCGACGCCGAACGCAAGGACGGCTGGTGCGAGCTGGGCGTCTTCCTC
AAGATCCAGGAGAGCATGCCGGCCAAGGCCAAGTTCGACTATGCCTGCTTCGGCCACTATCCACCCGTCTCGTAC
GGAGAGGTCAAAGACGGTGCTCCGCCGTGA
Transcript >Ophcf2|00301
ATGAGCCAGTCCAACAACGTCATCAAGCAGGGCTCCGTCGACTACGAGCCCGTCCATCAAGATGAGGAGGATCCT
CACTCGGACCGACCCGCCCCCCTGAGGAGGAGCTCCGAGGCGGAATTGCGCCATCTCAGATTCGCCGTCTACCTG
CTGGCCCCGTGCTTGGCCATCCTGGCCGCCTTCAACATCTTCCAGTTCTGGCCTTCATTCGAGTCGGATGGATGC
TCTCACAAGCGGTCCAAGGTGCCGCAGTACTTTCAGACGTCGCCAGAGCTATGGGCCGGACCGACGGCCACCGGC
AAGCCGCCCTTCTTGGCTGAAACCATCTCGTGGGCACCGACCCAGACCTACGTGCCCAACGAGCCGCTGGAGACG
TCGGTTCCCGTTGAGGGCATGGCACCCGGAGACGAGAACATCTTCCATCTCATGGGTCACTTGTCGCCGTATAAG
GCCGCGCCCGGCTTCGGCGTCGAAGAGTACCCTCTGCCCGAAGGTGCCGAAATCATGCAGGTTCAGATGCTCTCT
CGTCACGGATCCCGCTACCCCGGTACCGACTCCGAGGTCGAGCAGCTCGCCCACCGCCTAGGCAATGCTTCATCA
TCCGAATTCAATACAAAGGGCCCTCTAGCCTTTCTCAAAGACTGGAAGTACCAGCTCGGGCTCGAGATCCTCGTG
TCCAATGGCCGCAAGGAGCTCTTCAACTCGGGCATCTTGCACAGTTACATGTACGGGGCCATGTACAACACTGGT
AGCAAGATTATTGCTCGCACCACGACGCAAGATCGAATGCTCAAGTCGGCCGAGAACTGGCTGGCCGGCTTCTTC
GGCCTCGACTGGACCAAGAACGCCACCATCGAAGTCATCATTGATGACACCGGCTTCAACAACTCGCTCTCGGGC
GCCAACAATTGCCCCAATGCGATACCCCAGACGGTCGGCAAGGCTGCTGCGGCCGTCTGGATGGATAAGTATCTT
CAGAACGCCGTCGCTCGCTTCCAGAACATGACCGAGGGTTTCAACTGGACTATCCAAGACGTCTACGCTGCCCAG
ACGATGTGCCCTTATGAGACTGTCGCCCTCGGATCCAGCAAGTTCTGCGACTTGTTTACATACGAAGAATGGAAG
GGCTACAACTACGCCGTCAACCTGTACTTTGCCGGAGCGGCGGCTTTCAATAGTCCCACGGGTCGCGCCATGGGA
CTCGGCTATCAGCAGGAGATGGTGGCGCGGCTACAGAACCATACGCTCGGCTATTCCGGCTCGCAGATCAACGTG
ACGCTCGACAACAACACCGAGACCTTTCCGCTGAACCAGACGCTTTACTTTGACTTTTCCCACGACACCACCATC
GTCGCCGCCTTGACGGCCATGGGCCTCGTCCAGTTCAACGAGTCTCTTCCGGACACGGGCCCTCCTCCGGAGCAG
GGGTGGTTCGTAGTGTCCAACATGGTCCCATTCGGCTCCCGCTTCGACCTCGAGGTCATCAGGACGCCAAAGCCC
GTCTCTGCCGCCCGAGACGGCTACGTGGAAGGCGGCGAGACGCGTTACGTTCACCTGGTACTGAACCAGCGCACC
GTGCCCCTGGGCAAGAGCTTCCCCGAGTGCGACGCCGAACGCAAGGACGGCTGGTGCGAGCTGGGCGTCTTCCTC
AAGATCCAGGAGAGCATGCCGGCCAAGGCCAAGTTCGACTATGCCTGCTTCGGCCACTATCCACCCGTCTCGTAC
GGAGAGGTCAAAGACGGTGCTCCGCCGTGA
Gene >Ophcf2|00301
ATGAGCCAGTCCAACAACGTCATCAAGCAGGGCTCCGTCGACTACGAGCCCGTCCATCAAGATGAGGAGGATCCT
CACTCGGACCGACCCGCCCCCCTGAGGAGGAGCTCCGAGGCGGAATTGCGCCATCTCAGATTCGCCGTCTACCTG
CTGGCCCCGTGCTTGGCCATCCTGGCCGCCTTCAACATCTTCCAGTTCTGGCCTTCATTCGAGTCGGATGGATGC
TCTCACAAGCGGTCCAAGGTGCCGCAGTACTTTCAGACGTCGCCAGAGCTATGGGCCGGACCGACGGCCACCGGC
AAGCCGCCCTTCTTGGCTGAAACCATCTCGTGGGCACCGACCCAGACCTACGTGCCCAACGAGCCGCTGGAGACG
TCGGTTCCCGTTGAGGGCATGGCACCCGGAGACGAGAACATCTTCCATCTCATGGGTCACTTGTCGCCGTATAAG
GCCGCGCCCGGCTTCGGCGTCGAAGAGTACCCTCTGCCCGAAGGTGCCGAAATCATGCAGGTTCAGATGCTCTCT
CGTCACGGATCCCGCTACCCCGGTACCGACTCCGAGGTCGAGCAGCTCGCCCACCGCCTAGGCAATGCTTCATCA
TCCGAATTCAATACAAAGGGCCCTCTAGCCTTTCTCAAAGACTGGAAGTACCAGCTCGGGCTCGAGATCCTCGTG
TCCAATGGCCGCAAGGAGCTCTTCAACTCGGGTTCGTCCGTCAGCTCCCCGTGTGTTTGCTAGCAGTCGGCTAAC
GAGGGCCAGGCATCTTGCACAGTTACATGTACGGGGCCATGTACAACACTGGTAGCAAGATTATTGCTCGCACCA
CGGCAAGTCATGCATAGAAACTCGACCTCTGCGGCTGGCTTGCTGACCTCTTCCATAGACGCAAGATCGAATGCT
CAAGTCGGCCGAGAACTGGCTGGCCGGCTTCTTCGGCCTCGACTGGTCCGTGACCCGTGTCCGTGTCAATTCCTT
TCTCACATTGTCTCGCGCAGGACCAAGAACGCCACCATCGAAGTCATCATTGATGACACCGGCTTCAACAACTCG
CTCTCGGGCGCCAACAATTGCCCCAATGCGATACCCCAGACGGTCGGCAAGGCTGCTGCGGCCGTCTGGATGGAT
AAGTATCTTCAGAACGGTCCGCCATCCCTGCCCGATAGATTACGCCGTGGTGATGTTTGGAGCTGACGTCGATCA
GCCGTCGCTCGCTTCCAGAACATGACCGAGGGTTTCAACTGGACTATCCAAGACGTCTACGCTGCCCAGACGATG
TGCCCTTATGAGACTGTCGCCCTCGGATCCAGCAAGTTCTGCGACTTGTTTACATACGAAGAATGGAAGGGCTAC
AACTACGCCGTCAACCTGTACTTTGCCGGAGCGGCGGCTTTCAATAGTCCCACGGGTGTGAGTCTTTTTGTCTGA
TGGTCGTTTGGACTTTGACTTACGTGATGTGATGACTTCCACCAGCGCGCCATGGGACTCGGCTATCAGCAGGAG
ATGGTGGCGCGGCTACAGAACCATACGCTCGGCTATTCCGGCTCGCAGATCAACGTGACGCTCGACAACAACACC
GAGACCTTTCCGCTGAACCAGACGCTTTACTTTGACTTTTCCCACGACACCACCATCGTCGCCGCCTTGACGGCC
ATGGGCCTCGTCCAGTTCAACGAGTCTCTTCCGGACACGGGCCCTCCTCCGGAGCAGGGGTGGTTCGTAGTGTCC
AACATGGTCCCATTCGGCTCCCGCTTCGACCTCGAGGTCATCAGGACGCCAAAGCCCGTCTCTGCCGCCCGAGAC
GGCTACGTGGAAGGCGGCGAGACGCGTTACGTTCACCTGGTACTGAACCAGCGCACCGTGCCCCTGGGCAAGAGC
TTCCCCGAGTGCGACGCCGAACGCAAGGACGGCTGGTGCGAGCTGGGCGTCTTCCTCAAGATCCAGGAGAGCATG
CCGGCCAAGGCCAAGTTCGACTATGCCTGCTTCGGCCACTATCCACCCGTCTCGTACGGAGAGGTCAAAGACGGT
GCTCCGCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail