Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00293
Gene name
Locationscaffold_01:1395097..1396972
Strand+
Gene length (bp)1875
Transcript length (bp)1713
Coding sequence length (bp)1713
Protein length (aa) 571

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14671 DSPn Dual specificity protein phosphatase, N-terminal half 3.6E-40 11 169
PF00782 DSPc Dual specificity phosphatase, catalytic domain 5.8E-15 262 345
PF00102 Y_phosphatase Protein-tyrosine phosphatase 6.0E-05 273 339

GO

GO Term Description Terminal node
GO:0006470 protein dephosphorylation Yes
GO:0008138 protein tyrosine/serine/threonine phosphatase activity Yes
GO:0016311 dephosphorylation Yes
GO:0004725 protein tyrosine phosphatase activity Yes
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0036211 protein modification process No
GO:0042578 phosphoric ester hydrolase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No
GO:0003824 catalytic activity No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0016791 phosphatase activity No
GO:0043412 macromolecule modification No
GO:0004721 phosphoprotein phosphatase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0008150 biological_process No
GO:0006793 phosphorus metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5972 0.688 0.0731 0.1329 0.0966 0.0083 0.0527 0.1042 0.0721 0.012

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2788
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|185
Ophiocordyceps australis map64 (Brazil) OphauB2|4329
Ophiocordyceps camponoti-floridani Ophcf2|00293 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7582
Ophiocordyceps kimflemingae Ophio5|7862
Ophiocordyceps subramaniannii Hirsu2|4467

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00293
MAPSGRHNVVEYIPDRLYLAAYSQAPARDSPLEFPASSSSSRKRARTTMTPCYFTMDDTLLYNAFHHDFGPLHIG
HLYRFAIRFHDILGAKENKDRPVVFWSAADARSRANAACMLACYMVLIQSWPPHLALAPIAQVEPPLMPFRDAGY
SQADYGLSVQDVVYGVWRAKEERCCDLDSFDLETYERFERVEHGDFNWITPHFVAFASPQHDDEAETEIPTPFSN
VLEHFDERRVGLVVRLNSPLYRARHFEDRGMRHLDMIFDDGTCPPMTTVRRFIKLANETIADGGKAIAVHCKAGL
GRTGCLIGAYLIYRHGFTANEVMSFMRFMRPGMVVGPQQHWLHLHQGTFREWAVEERVEKRLRREMMAAGPSTPV
RAMQKTSLRNSLSTPNRSPSTRTPLGEVEHNNNNNNNNNNNNNNNNDCLPAPTPGQPRKTARHHPYQRAVSSSSA
VEADLDATASEREDGDLDGEPHHVRAVRSHHHHPHPHPHSHQQHHHQQQQQQQQQQQPSSPRRASPCRSRATSVV
VIDNDASLDVENVLRVTKACSVSSRLSPRVRKVSGRVGGRKASGT*
Coding >Ophcf2|00293
ATGGCTCCGTCTGGGCGGCACAATGTCGTCGAGTACATCCCAGATCGTCTCTATCTCGCGGCCTATTCGCAGGCT
CCGGCGCGAGATTCGCCGCTCGAGTTTCCGGCTTCTTCGTCTTCGTCTAGGAAGAGGGCGCGGACGACGATGACT
CCTTGCTACTTTACCATGGACGACACCCTGCTCTACAACGCCTTTCACCATGATTTCGGTCCCCTGCATATCGGA
CATTTGTATCGGTTCGCCATTCGTTTCCATGATATACTGGGTGCCAAGGAGAACAAGGATCGGCCAGTGGTGTTT
TGGAGCGCTGCCGACGCCCGGAGCCGGGCAAACGCAGCGTGTATGCTGGCCTGCTACATGGTCCTCATCCAAAGC
TGGCCTCCGCACCTGGCACTCGCTCCCATCGCGCAGGTCGAGCCACCGCTGATGCCCTTCCGCGACGCGGGATAC
AGCCAGGCCGACTACGGACTCAGCGTGCAGGACGTTGTTTACGGCGTGTGGCGGGCCAAGGAGGAGAGGTGCTGC
GATCTCGACAGCTTCGATCTCGAGACGTACGAGCGGTTTGAGAGGGTCGAGCACGGGGACTTTAACTGGATTACG
CCGCATTTCGTGGCTTTTGCCTCGCCGCAGCACGACGACGAGGCTGAGACGGAGATTCCCACCCCCTTCTCCAAC
GTTCTGGAGCACTTCGACGAGAGGCGGGTTGGCCTCGTTGTCAGGCTCAACTCTCCCCTCTATCGTGCCCGTCAC
TTTGAGGATAGGGGCATGCGTCACCTGGACATGATCTTCGACGACGGCACGTGTCCTCCCATGACGACGGTACGA
CGCTTCATCAAGCTGGCCAACGAGACCATCGCCGACGGAGGAAAAGCCATAGCCGTACACTGCAAGGCCGGACTC
GGACGGACGGGCTGCCTGATCGGAGCCTACCTCATCTATCGGCACGGCTTCACGGCCAACGAGGTCATGTCGTTT
ATGCGCTTCATGAGGCCGGGGATGGTGGTCGGACCGCAGCAGCACTGGCTTCATCTCCATCAGGGTACCTTTCGC
GAGTGGGCGGTCGAGGAGAGGGTCGAGAAGAGGTTGAGGCGGGAGATGATGGCCGCTGGGCCGAGTACGCCGGTG
AGGGCGATGCAGAAGACGTCTCTGAGGAATAGTCTCTCGACGCCGAACCGGTCGCCTTCTACGCGGACGCCTTTG
GGAGAGGTTGAGCACAACAACAACAACAATAACAACAACAACAACAACAACAACAACAACAACGACTGTCTACCC
GCTCCCACTCCCGGTCAGCCGCGAAAGACGGCGAGACATCACCCTTACCAACGCGCCGTATCGTCATCATCCGCC
GTCGAGGCCGATCTCGACGCCACGGCTTCGGAGAGGGAAGACGGAGACTTGGACGGCGAACCGCATCACGTGCGA
GCCGTCAGGAGCCATCACCACCATCCTCATCCTCACCCTCATTCCCATCAGCAGCATCACCACCAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCAGCCTTCCTCGCCGCGGCGCGCCTCGCCCTGTCGTTCGCGGGCCACGAGCGTGGTG
GTGATTGACAATGACGCCTCGCTCGACGTCGAGAACGTGCTTCGAGTTACAAAGGCTTGTTCCGTCTCGTCGAGG
CTTTCGCCTAGGGTTCGGAAGGTTAGTGGGCGGGTCGGGGGGAGGAAGGCGTCTGGGACGTAA
Transcript >Ophcf2|00293
ATGGCTCCGTCTGGGCGGCACAATGTCGTCGAGTACATCCCAGATCGTCTCTATCTCGCGGCCTATTCGCAGGCT
CCGGCGCGAGATTCGCCGCTCGAGTTTCCGGCTTCTTCGTCTTCGTCTAGGAAGAGGGCGCGGACGACGATGACT
CCTTGCTACTTTACCATGGACGACACCCTGCTCTACAACGCCTTTCACCATGATTTCGGTCCCCTGCATATCGGA
CATTTGTATCGGTTCGCCATTCGTTTCCATGATATACTGGGTGCCAAGGAGAACAAGGATCGGCCAGTGGTGTTT
TGGAGCGCTGCCGACGCCCGGAGCCGGGCAAACGCAGCGTGTATGCTGGCCTGCTACATGGTCCTCATCCAAAGC
TGGCCTCCGCACCTGGCACTCGCTCCCATCGCGCAGGTCGAGCCACCGCTGATGCCCTTCCGCGACGCGGGATAC
AGCCAGGCCGACTACGGACTCAGCGTGCAGGACGTTGTTTACGGCGTGTGGCGGGCCAAGGAGGAGAGGTGCTGC
GATCTCGACAGCTTCGATCTCGAGACGTACGAGCGGTTTGAGAGGGTCGAGCACGGGGACTTTAACTGGATTACG
CCGCATTTCGTGGCTTTTGCCTCGCCGCAGCACGACGACGAGGCTGAGACGGAGATTCCCACCCCCTTCTCCAAC
GTTCTGGAGCACTTCGACGAGAGGCGGGTTGGCCTCGTTGTCAGGCTCAACTCTCCCCTCTATCGTGCCCGTCAC
TTTGAGGATAGGGGCATGCGTCACCTGGACATGATCTTCGACGACGGCACGTGTCCTCCCATGACGACGGTACGA
CGCTTCATCAAGCTGGCCAACGAGACCATCGCCGACGGAGGAAAAGCCATAGCCGTACACTGCAAGGCCGGACTC
GGACGGACGGGCTGCCTGATCGGAGCCTACCTCATCTATCGGCACGGCTTCACGGCCAACGAGGTCATGTCGTTT
ATGCGCTTCATGAGGCCGGGGATGGTGGTCGGACCGCAGCAGCACTGGCTTCATCTCCATCAGGGTACCTTTCGC
GAGTGGGCGGTCGAGGAGAGGGTCGAGAAGAGGTTGAGGCGGGAGATGATGGCCGCTGGGCCGAGTACGCCGGTG
AGGGCGATGCAGAAGACGTCTCTGAGGAATAGTCTCTCGACGCCGAACCGGTCGCCTTCTACGCGGACGCCTTTG
GGAGAGGTTGAGCACAACAACAACAACAATAACAACAACAACAACAACAACAACAACAACAACGACTGTCTACCC
GCTCCCACTCCCGGTCAGCCGCGAAAGACGGCGAGACATCACCCTTACCAACGCGCCGTATCGTCATCATCCGCC
GTCGAGGCCGATCTCGACGCCACGGCTTCGGAGAGGGAAGACGGAGACTTGGACGGCGAACCGCATCACGTGCGA
GCCGTCAGGAGCCATCACCACCATCCTCATCCTCACCCTCATTCCCATCAGCAGCATCACCACCAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCAGCCTTCCTCGCCGCGGCGCGCCTCGCCCTGTCGTTCGCGGGCCACGAGCGTGGTG
GTGATTGACAATGACGCCTCGCTCGACGTCGAGAACGTGCTTCGAGTTACAAAGGCTTGTTCCGTCTCGTCGAGG
CTTTCGCCTAGGGTTCGGAAGGTTAGTGGGCGGGTCGGGGGGAGGAAGGCGTCTGGGACGTAA
Gene >Ophcf2|00293
ATGGCTCCGTCTGGGCGGCACAATGTCGTCGAGTACATCCCAGGTGAGGAGACCATCCGCGTGGCATCAGACCTT
GTTGTTGCTGTTCGAAAGGCTAACATGATGTCGTCAAGATCGTCTCTATCTCGCGGCCTATTCGCAGGCTCCGGC
GCGAGATTCGCCGCTCGAGTTTCCGGCTTCTTCGTCTTCGTCTAGGAAGAGGGCGCGGACGACGATGACTCCTTG
CTACTTTACCATGGACGACACCCTGCTCTACAACGCCTTTCACCATGATTTCGGTCCCCTGCATATCGGACATTT
GTATCGGTTCGCCATTCGTTTCCATGATATACTGGGTGCCAAGGAGAACAAGGATCGGCCAGTGGTGTTTTGGAG
CGCTGCCGACGCCCGGAGTGAGCCACTCTCCCCCTTTCTTTCCCCCTTCCTCGGCCTCCTTCTTCCATCGAACAG
AACTGACGGACGGGAATTTTTCCTCTCTCTCAAGGCCGGGCAAACGCAGCGTGTATGCTGGCCTGCTACATGGTC
CTCATCCAAAGCTGGCCTCCGCACCTGGCACTCGCTCCCATCGCGCAGGTCGAGCCACCGCTGATGCCCTTCCGC
GACGCGGGATACAGCCAGGCCGACTACGGACTCAGCGTGCAGGACGTTGTTTACGGCGTGTGGCGGGCCAAGGAG
GAGAGGTGCTGCGATCTCGACAGCTTCGATCTCGAGACGTACGAGCGGTTTGAGAGGGTCGAGCACGGGGACTTT
AACTGGATTACGCCGCATTTCGTGGCTTTTGCCTCGCCGCAGCACGACGACGAGGCTGAGACGGAGATTCCCACC
CCCTTCTCCAACGTTCTGGAGCACTTCGACGAGAGGCGGGTTGGCCTCGTTGTCAGGCTCAACTCTCCCCTCTAT
CGTGCCCGTCACTTTGAGGATAGGGGCATGCGTCACCTGGACATGATCTTCGACGACGGCACGTGTCCTCCCATG
ACGACGGTACGACGCTTCATCAAGCTGGCCAACGAGACCATCGCCGACGGAGGAAAAGCCATAGCCGTACACTGC
AAGGCCGGACTCGGACGGACGGGCTGCCTGATCGGAGCCTACCTCATCTATCGGCACGGCTTCACGGCCAACGAG
GTCATGTCGTTTATGCGCTTCATGAGGCCGGGGATGGTGGTCGGACCGCAGCAGCACTGGCTTCATCTCCATCAG
GGTACCTTTCGCGAGTGGGCGGTCGAGGAGAGGGTCGAGAAGAGGTTGAGGCGGGAGATGATGGCCGCTGGGCCG
AGTACGCCGGTGAGGGCGATGCAGAAGACGTCTCTGAGGAATAGTCTCTCGACGCCGAACCGGTCGCCTTCTACG
CGGACGCCTTTGGGAGAGGTTGAGCACAACAACAACAACAATAACAACAACAACAACAACAACAACAACAACAAC
GACTGTCTACCCGCTCCCACTCCCGGTCAGCCGCGAAAGACGGCGAGACATCACCCTTACCAACGCGCCGTATCG
TCATCATCCGCCGTCGAGGCCGATCTCGACGCCACGGCTTCGGAGAGGGAAGACGGAGACTTGGACGGCGAACCG
CATCACGTGCGAGCCGTCAGGAGCCATCACCACCATCCTCATCCTCACCCTCATTCCCATCAGCAGCATCACCAC
CAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCTTCCTCGCCGCGGCGCGCCTCGCCCTGTCGTTCGCGGGCC
ACGAGCGTGGTGGTGATTGACAATGACGCCTCGCTCGACGTCGAGAACGTGCTTCGAGTTACAAAGGCTTGTTCC
GTCTCGTCGAGGCTTTCGCCTAGGGTTCGGAAGGTTAGTGGGCGGGTCGGGGGGAGGAAGGCGTCTGGGACGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail