Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00290
Gene name
Locationscaffold_01:1388945..1390955
Strand+
Gene length (bp)2010
Transcript length (bp)2010
Coding sequence length (bp)2010
Protein length (aa) 670

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 374 396 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 88.15 49.03 127.27
Alive In ants, during behavior modification 315.82 128.56 503.08
Dead In ants, recently dead 446.69 183.55 709.83

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.116877 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00290
MSIPEPPASLDDACFAIHNGTLFAYSSHGFFSLVLDKGAAWRKLDMGVPVEGAPCLSTTPLDASQAALFVVGGRT
DSGDYPGLQRYTYDDGQWSTIRLTDEVTKQRLGHAVTYVASDDVILMYAGHQDGTNGLSSQTFAIQSSHPFTVRG
YESVAPPADSPVLFAWSASDAGMLTGGNGPLDDRPWLWNPSSGWRSWETTISAPFKVTPLTRLVPVDGDDGSKFL
YAFDFGQSPVAVSVMVLQDGAGNPGPSTPSDVSRRVAVSRRDLGSKSLPVYNATLAPAGRKRLPAVASDGNGTVV
FAGGGQDGALLVFNGKKNTWVDVGAMLGDGSKAFLAPTSASPTETPSSTSTSGASTSTTAAGNRGRTGPGPNALL
GITLGCILGLMALLGIVLFLLRRRKKLRRRKAADDDSEEKEAEDMSPSTIPPKSHFRGHHPQASHESYSSMAILM
GRVGKDRGLTRKTSHDTNRSSDSSLHKKFKSTISKPIPQPAAYPVLPGPYDDDKNASLAPKAAAAVAAAAAAAES
NDTTRRSSGWNRYWSGGSALQILGLGPTRRNTTMSERSSHYSDSGNRMRQDSATVPPLTMDGRPEVNSVAVNSPT
VARLATAEGMAGRIVRPTSPASSGYSSGIPESVVDGWDTASGGGRGGHRRAGSTARATTRPRAGPFLRG*
Coding >Ophcf2|00290
ATGTCCATCCCGGAGCCTCCGGCTTCGTTGGACGACGCATGCTTCGCAATACACAACGGCACCCTGTTTGCCTAC
TCGTCTCATGGCTTCTTTTCCTTAGTACTCGACAAGGGCGCCGCCTGGCGGAAGCTCGACATGGGCGTCCCCGTC
GAGGGCGCCCCCTGTCTGAGCACGACGCCTCTCGACGCCAGCCAGGCCGCCTTGTTCGTCGTCGGCGGCCGTACA
GACTCGGGCGACTACCCGGGCCTGCAAAGATATACATACGATGACGGCCAGTGGTCTACCATCCGCCTCACCGAC
GAGGTCACCAAGCAACGACTGGGTCACGCCGTAACCTACGTCGCCTCTGACGATGTCATTCTCATGTACGCCGGT
CATCAGGATGGCACCAATGGCCTCTCCTCTCAGACCTTTGCCATTCAGTCCTCCCATCCCTTTACCGTCCGCGGA
TACGAATCCGTCGCGCCCCCGGCCGACTCACCTGTTCTCTTTGCTTGGTCCGCCTCCGACGCTGGCATGCTCACG
GGAGGCAACGGTCCGCTCGACGATCGTCCCTGGCTATGGAACCCTTCATCCGGCTGGAGAAGCTGGGAGACGACA
ATATCGGCTCCTTTCAAGGTGACGCCGCTCACGCGCCTCGTCCCGGTCGATGGCGACGACGGGTCCAAGTTCCTC
TACGCCTTCGATTTTGGCCAATCTCCTGTAGCCGTCAGCGTCATGGTCCTGCAGGACGGCGCGGGTAACCCGGGC
CCCAGCACGCCCTCGGATGTCAGCAGGAGGGTCGCTGTTTCCAGACGCGACTTGGGCTCCAAGAGCTTGCCGGTC
TACAACGCGACCCTGGCACCCGCGGGCCGGAAACGTCTGCCCGCCGTGGCCTCGGATGGCAACGGCACCGTCGTC
TTCGCGGGCGGTGGCCAGGACGGCGCGTTGCTCGTGTTCAACGGCAAGAAGAATACCTGGGTCGACGTCGGAGCC
ATGCTCGGCGACGGCAGCAAGGCTTTCCTGGCGCCGACGAGCGCGTCGCCCACGGAGACGCCCTCGAGCACGAGC
ACGTCGGGAGCGTCTACGTCGACGACGGCAGCCGGCAACCGGGGCAGGACCGGACCCGGGCCCAATGCCTTGCTG
GGCATCACCCTGGGCTGCATCCTCGGTCTGATGGCCCTCCTCGGTATCGTCCTTTTTCTCCTCCGGCGGCGCAAG
AAGCTCCGCAGACGCAAGGCGGCCGACGACGATTCGGAGGAGAAGGAAGCCGAGGACATGTCACCCAGCACGATA
CCTCCCAAGTCTCATTTCCGCGGTCATCACCCGCAAGCGTCTCACGAGTCCTATTCGTCCATGGCCATTCTGATG
GGTCGAGTCGGCAAGGATAGGGGCCTGACGCGCAAGACGAGCCACGACACGAACCGGAGCTCGGACAGCTCGCTG
CACAAGAAGTTCAAGAGCACCATCAGCAAGCCGATACCACAGCCGGCGGCCTACCCGGTGCTGCCGGGCCCATAT
GACGATGACAAGAACGCGAGCCTGGCGCCCAAGGCGGCGGCGGCGGTGGCGGCGGCGGCGGCGGCGGCCGAATCA
AATGACACGACGCGGAGGAGCTCCGGCTGGAACCGTTATTGGTCCGGGGGAAGCGCCCTTCAGATCCTGGGTCTG
GGGCCGACGCGGAGGAACACGACGATGTCGGAGCGGAGCTCGCACTACTCGGACAGCGGCAACCGGATGCGGCAG
GACTCGGCCACAGTACCGCCGCTGACGATGGACGGACGGCCAGAGGTCAACAGCGTGGCGGTCAACAGCCCGACT
GTGGCGCGGCTGGCGACGGCGGAGGGCATGGCGGGCCGGATCGTGCGGCCGACGTCTCCGGCGTCTTCGGGCTAC
TCGAGCGGCATCCCGGAGAGCGTCGTCGACGGCTGGGACACGGCTTCGGGCGGCGGTCGGGGTGGACATCGCCGG
GCGGGGTCCACGGCTCGAGCTACTACGCGGCCTCGGGCCGGGCCGTTCCTTCGGGGATGA
Transcript >Ophcf2|00290
ATGTCCATCCCGGAGCCTCCGGCTTCGTTGGACGACGCATGCTTCGCAATACACAACGGCACCCTGTTTGCCTAC
TCGTCTCATGGCTTCTTTTCCTTAGTACTCGACAAGGGCGCCGCCTGGCGGAAGCTCGACATGGGCGTCCCCGTC
GAGGGCGCCCCCTGTCTGAGCACGACGCCTCTCGACGCCAGCCAGGCCGCCTTGTTCGTCGTCGGCGGCCGTACA
GACTCGGGCGACTACCCGGGCCTGCAAAGATATACATACGATGACGGCCAGTGGTCTACCATCCGCCTCACCGAC
GAGGTCACCAAGCAACGACTGGGTCACGCCGTAACCTACGTCGCCTCTGACGATGTCATTCTCATGTACGCCGGT
CATCAGGATGGCACCAATGGCCTCTCCTCTCAGACCTTTGCCATTCAGTCCTCCCATCCCTTTACCGTCCGCGGA
TACGAATCCGTCGCGCCCCCGGCCGACTCACCTGTTCTCTTTGCTTGGTCCGCCTCCGACGCTGGCATGCTCACG
GGAGGCAACGGTCCGCTCGACGATCGTCCCTGGCTATGGAACCCTTCATCCGGCTGGAGAAGCTGGGAGACGACA
ATATCGGCTCCTTTCAAGGTGACGCCGCTCACGCGCCTCGTCCCGGTCGATGGCGACGACGGGTCCAAGTTCCTC
TACGCCTTCGATTTTGGCCAATCTCCTGTAGCCGTCAGCGTCATGGTCCTGCAGGACGGCGCGGGTAACCCGGGC
CCCAGCACGCCCTCGGATGTCAGCAGGAGGGTCGCTGTTTCCAGACGCGACTTGGGCTCCAAGAGCTTGCCGGTC
TACAACGCGACCCTGGCACCCGCGGGCCGGAAACGTCTGCCCGCCGTGGCCTCGGATGGCAACGGCACCGTCGTC
TTCGCGGGCGGTGGCCAGGACGGCGCGTTGCTCGTGTTCAACGGCAAGAAGAATACCTGGGTCGACGTCGGAGCC
ATGCTCGGCGACGGCAGCAAGGCTTTCCTGGCGCCGACGAGCGCGTCGCCCACGGAGACGCCCTCGAGCACGAGC
ACGTCGGGAGCGTCTACGTCGACGACGGCAGCCGGCAACCGGGGCAGGACCGGACCCGGGCCCAATGCCTTGCTG
GGCATCACCCTGGGCTGCATCCTCGGTCTGATGGCCCTCCTCGGTATCGTCCTTTTTCTCCTCCGGCGGCGCAAG
AAGCTCCGCAGACGCAAGGCGGCCGACGACGATTCGGAGGAGAAGGAAGCCGAGGACATGTCACCCAGCACGATA
CCTCCCAAGTCTCATTTCCGCGGTCATCACCCGCAAGCGTCTCACGAGTCCTATTCGTCCATGGCCATTCTGATG
GGTCGAGTCGGCAAGGATAGGGGCCTGACGCGCAAGACGAGCCACGACACGAACCGGAGCTCGGACAGCTCGCTG
CACAAGAAGTTCAAGAGCACCATCAGCAAGCCGATACCACAGCCGGCGGCCTACCCGGTGCTGCCGGGCCCATAT
GACGATGACAAGAACGCGAGCCTGGCGCCCAAGGCGGCGGCGGCGGTGGCGGCGGCGGCGGCGGCGGCCGAATCA
AATGACACGACGCGGAGGAGCTCCGGCTGGAACCGTTATTGGTCCGGGGGAAGCGCCCTTCAGATCCTGGGTCTG
GGGCCGACGCGGAGGAACACGACGATGTCGGAGCGGAGCTCGCACTACTCGGACAGCGGCAACCGGATGCGGCAG
GACTCGGCCACAGTACCGCCGCTGACGATGGACGGACGGCCAGAGGTCAACAGCGTGGCGGTCAACAGCCCGACT
GTGGCGCGGCTGGCGACGGCGGAGGGCATGGCGGGCCGGATCGTGCGGCCGACGTCTCCGGCGTCTTCGGGCTAC
TCGAGCGGCATCCCGGAGAGCGTCGTCGACGGCTGGGACACGGCTTCGGGCGGCGGTCGGGGTGGACATCGCCGG
GCGGGGTCCACGGCTCGAGCTACTACGCGGCCTCGGGCCGGGCCGTTCCTTCGGGGATGA
Gene >Ophcf2|00290
ATGTCCATCCCGGAGCCTCCGGCTTCGTTGGACGACGCATGCTTCGCAATACACAACGGCACCCTGTTTGCCTAC
TCGTCTCATGGCTTCTTTTCCTTAGTACTCGACAAGGGCGCCGCCTGGCGGAAGCTCGACATGGGCGTCCCCGTC
GAGGGCGCCCCCTGTCTGAGCACGACGCCTCTCGACGCCAGCCAGGCCGCCTTGTTCGTCGTCGGCGGCCGTACA
GACTCGGGCGACTACCCGGGCCTGCAAAGATATACATACGATGACGGCCAGTGGTCTACCATCCGCCTCACCGAC
GAGGTCACCAAGCAACGACTGGGTCACGCCGTAACCTACGTCGCCTCTGACGATGTCATTCTCATGTACGCCGGT
CATCAGGATGGCACCAATGGCCTCTCCTCTCAGACCTTTGCCATTCAGTCCTCCCATCCCTTTACCGTCCGCGGA
TACGAATCCGTCGCGCCCCCGGCCGACTCACCTGTTCTCTTTGCTTGGTCCGCCTCCGACGCTGGCATGCTCACG
GGAGGCAACGGTCCGCTCGACGATCGTCCCTGGCTATGGAACCCTTCATCCGGCTGGAGAAGCTGGGAGACGACA
ATATCGGCTCCTTTCAAGGTGACGCCGCTCACGCGCCTCGTCCCGGTCGATGGCGACGACGGGTCCAAGTTCCTC
TACGCCTTCGATTTTGGCCAATCTCCTGTAGCCGTCAGCGTCATGGTCCTGCAGGACGGCGCGGGTAACCCGGGC
CCCAGCACGCCCTCGGATGTCAGCAGGAGGGTCGCTGTTTCCAGACGCGACTTGGGCTCCAAGAGCTTGCCGGTC
TACAACGCGACCCTGGCACCCGCGGGCCGGAAACGTCTGCCCGCCGTGGCCTCGGATGGCAACGGCACCGTCGTC
TTCGCGGGCGGTGGCCAGGACGGCGCGTTGCTCGTGTTCAACGGCAAGAAGAATACCTGGGTCGACGTCGGAGCC
ATGCTCGGCGACGGCAGCAAGGCTTTCCTGGCGCCGACGAGCGCGTCGCCCACGGAGACGCCCTCGAGCACGAGC
ACGTCGGGAGCGTCTACGTCGACGACGGCAGCCGGCAACCGGGGCAGGACCGGACCCGGGCCCAATGCCTTGCTG
GGCATCACCCTGGGCTGCATCCTCGGTCTGATGGCCCTCCTCGGTATCGTCCTTTTTCTCCTCCGGCGGCGCAAG
AAGCTCCGCAGACGCAAGGCGGCCGACGACGATTCGGAGGAGAAGGAAGCCGAGGACATGTCACCCAGCACGATA
CCTCCCAAGTCTCATTTCCGCGGTCATCACCCGCAAGCGTCTCACGAGTCCTATTCGTCCATGGCCATTCTGATG
GGTCGAGTCGGCAAGGATAGGGGCCTGACGCGCAAGACGAGCCACGACACGAACCGGAGCTCGGACAGCTCGCTG
CACAAGAAGTTCAAGAGCACCATCAGCAAGCCGATACCACAGCCGGCGGCCTACCCGGTGCTGCCGGGCCCATAT
GACGATGACAAGAACGCGAGCCTGGCGCCCAAGGCGGCGGCGGCGGTGGCGGCGGCGGCGGCGGCGGCCGAATCA
AATGACACGACGCGGAGGAGCTCCGGCTGGAACCGTTATTGGTCCGGGGGAAGCGCCCTTCAGATCCTGGGTCTG
GGGCCGACGCGGAGGAACACGACGATGTCGGAGCGGAGCTCGCACTACTCGGACAGCGGCAACCGGATGCGGCAG
GACTCGGCCACAGTACCGCCGCTGACGATGGACGGACGGCCAGAGGTCAACAGCGTGGCGGTCAACAGCCCGACT
GTGGCGCGGCTGGCGACGGCGGAGGGCATGGCGGGCCGGATCGTGCGGCCGACGTCTCCGGCGTCTTCGGGCTAC
TCGAGCGGCATCCCGGAGAGCGTCGTCGACGGCTGGGACACGGCTTCGGGCGGCGGTCGGGGTGGACATCGCCGG
GCGGGGTCCACGGCTCGAGCTACTACGCGGCCTCGGGCCGGGCCGTTCCTTCGGGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail