Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00290
Gene name
Locationscaffold_01:1388945..1390955
Strand+
Gene length (bp)2010
Transcript length (bp)2010
Coding sequence length (bp)2010
Protein length (aa) 670

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane Signal peptide|Transmembrane domain 0.1097 0.1495 0.2668 0.5466 0.1016 0.0077 0.0958 0.3972 0.0947 0.1135

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 374 396 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4205
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3749
Ophiocordyceps australis map64 (Brazil) OphauB2|4326
Ophiocordyceps camponoti-floridani Ophcf2|00290 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7460
Ophiocordyceps kimflemingae Ophio5|7393
Ophiocordyceps subramaniannii Hirsu2|8563

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00290
MSIPEPPASLDDACFAIHNGTLFAYSSHGFFSLVLDKGAAWRKLDMGVPVEGAPCLSTTPLDASQAALFVVGGRT
DSGDYPGLQRYTYDDGQWSTIRLTDEVTKQRLGHAVTYVASDDVILMYAGHQDGTNGLSSQTFAIQSSHPFTVRG
YESVAPPADSPVLFAWSASDAGMLTGGNGPLDDRPWLWNPSSGWRSWETTISAPFKVTPLTRLVPVDGDDGSKFL
YAFDFGQSPVAVSVMVLQDGAGNPGPSTPSDVSRRVAVSRRDLGSKSLPVYNATLAPAGRKRLPAVASDGNGTVV
FAGGGQDGALLVFNGKKNTWVDVGAMLGDGSKAFLAPTSASPTETPSSTSTSGASTSTTAAGNRGRTGPGPNALL
GITLGCILGLMALLGIVLFLLRRRKKLRRRKAADDDSEEKEAEDMSPSTIPPKSHFRGHHPQASHESYSSMAILM
GRVGKDRGLTRKTSHDTNRSSDSSLHKKFKSTISKPIPQPAAYPVLPGPYDDDKNASLAPKAAAAVAAAAAAAES
NDTTRRSSGWNRYWSGGSALQILGLGPTRRNTTMSERSSHYSDSGNRMRQDSATVPPLTMDGRPEVNSVAVNSPT
VARLATAEGMAGRIVRPTSPASSGYSSGIPESVVDGWDTASGGGRGGHRRAGSTARATTRPRAGPFLRG*
Coding >Ophcf2|00290
ATGTCCATCCCGGAGCCTCCGGCTTCGTTGGACGACGCATGCTTCGCAATACACAACGGCACCCTGTTTGCCTAC
TCGTCTCATGGCTTCTTTTCCTTAGTACTCGACAAGGGCGCCGCCTGGCGGAAGCTCGACATGGGCGTCCCCGTC
GAGGGCGCCCCCTGTCTGAGCACGACGCCTCTCGACGCCAGCCAGGCCGCCTTGTTCGTCGTCGGCGGCCGTACA
GACTCGGGCGACTACCCGGGCCTGCAAAGATATACATACGATGACGGCCAGTGGTCTACCATCCGCCTCACCGAC
GAGGTCACCAAGCAACGACTGGGTCACGCCGTAACCTACGTCGCCTCTGACGATGTCATTCTCATGTACGCCGGT
CATCAGGATGGCACCAATGGCCTCTCCTCTCAGACCTTTGCCATTCAGTCCTCCCATCCCTTTACCGTCCGCGGA
TACGAATCCGTCGCGCCCCCGGCCGACTCACCTGTTCTCTTTGCTTGGTCCGCCTCCGACGCTGGCATGCTCACG
GGAGGCAACGGTCCGCTCGACGATCGTCCCTGGCTATGGAACCCTTCATCCGGCTGGAGAAGCTGGGAGACGACA
ATATCGGCTCCTTTCAAGGTGACGCCGCTCACGCGCCTCGTCCCGGTCGATGGCGACGACGGGTCCAAGTTCCTC
TACGCCTTCGATTTTGGCCAATCTCCTGTAGCCGTCAGCGTCATGGTCCTGCAGGACGGCGCGGGTAACCCGGGC
CCCAGCACGCCCTCGGATGTCAGCAGGAGGGTCGCTGTTTCCAGACGCGACTTGGGCTCCAAGAGCTTGCCGGTC
TACAACGCGACCCTGGCACCCGCGGGCCGGAAACGTCTGCCCGCCGTGGCCTCGGATGGCAACGGCACCGTCGTC
TTCGCGGGCGGTGGCCAGGACGGCGCGTTGCTCGTGTTCAACGGCAAGAAGAATACCTGGGTCGACGTCGGAGCC
ATGCTCGGCGACGGCAGCAAGGCTTTCCTGGCGCCGACGAGCGCGTCGCCCACGGAGACGCCCTCGAGCACGAGC
ACGTCGGGAGCGTCTACGTCGACGACGGCAGCCGGCAACCGGGGCAGGACCGGACCCGGGCCCAATGCCTTGCTG
GGCATCACCCTGGGCTGCATCCTCGGTCTGATGGCCCTCCTCGGTATCGTCCTTTTTCTCCTCCGGCGGCGCAAG
AAGCTCCGCAGACGCAAGGCGGCCGACGACGATTCGGAGGAGAAGGAAGCCGAGGACATGTCACCCAGCACGATA
CCTCCCAAGTCTCATTTCCGCGGTCATCACCCGCAAGCGTCTCACGAGTCCTATTCGTCCATGGCCATTCTGATG
GGTCGAGTCGGCAAGGATAGGGGCCTGACGCGCAAGACGAGCCACGACACGAACCGGAGCTCGGACAGCTCGCTG
CACAAGAAGTTCAAGAGCACCATCAGCAAGCCGATACCACAGCCGGCGGCCTACCCGGTGCTGCCGGGCCCATAT
GACGATGACAAGAACGCGAGCCTGGCGCCCAAGGCGGCGGCGGCGGTGGCGGCGGCGGCGGCGGCGGCCGAATCA
AATGACACGACGCGGAGGAGCTCCGGCTGGAACCGTTATTGGTCCGGGGGAAGCGCCCTTCAGATCCTGGGTCTG
GGGCCGACGCGGAGGAACACGACGATGTCGGAGCGGAGCTCGCACTACTCGGACAGCGGCAACCGGATGCGGCAG
GACTCGGCCACAGTACCGCCGCTGACGATGGACGGACGGCCAGAGGTCAACAGCGTGGCGGTCAACAGCCCGACT
GTGGCGCGGCTGGCGACGGCGGAGGGCATGGCGGGCCGGATCGTGCGGCCGACGTCTCCGGCGTCTTCGGGCTAC
TCGAGCGGCATCCCGGAGAGCGTCGTCGACGGCTGGGACACGGCTTCGGGCGGCGGTCGGGGTGGACATCGCCGG
GCGGGGTCCACGGCTCGAGCTACTACGCGGCCTCGGGCCGGGCCGTTCCTTCGGGGATGA
Transcript >Ophcf2|00290
ATGTCCATCCCGGAGCCTCCGGCTTCGTTGGACGACGCATGCTTCGCAATACACAACGGCACCCTGTTTGCCTAC
TCGTCTCATGGCTTCTTTTCCTTAGTACTCGACAAGGGCGCCGCCTGGCGGAAGCTCGACATGGGCGTCCCCGTC
GAGGGCGCCCCCTGTCTGAGCACGACGCCTCTCGACGCCAGCCAGGCCGCCTTGTTCGTCGTCGGCGGCCGTACA
GACTCGGGCGACTACCCGGGCCTGCAAAGATATACATACGATGACGGCCAGTGGTCTACCATCCGCCTCACCGAC
GAGGTCACCAAGCAACGACTGGGTCACGCCGTAACCTACGTCGCCTCTGACGATGTCATTCTCATGTACGCCGGT
CATCAGGATGGCACCAATGGCCTCTCCTCTCAGACCTTTGCCATTCAGTCCTCCCATCCCTTTACCGTCCGCGGA
TACGAATCCGTCGCGCCCCCGGCCGACTCACCTGTTCTCTTTGCTTGGTCCGCCTCCGACGCTGGCATGCTCACG
GGAGGCAACGGTCCGCTCGACGATCGTCCCTGGCTATGGAACCCTTCATCCGGCTGGAGAAGCTGGGAGACGACA
ATATCGGCTCCTTTCAAGGTGACGCCGCTCACGCGCCTCGTCCCGGTCGATGGCGACGACGGGTCCAAGTTCCTC
TACGCCTTCGATTTTGGCCAATCTCCTGTAGCCGTCAGCGTCATGGTCCTGCAGGACGGCGCGGGTAACCCGGGC
CCCAGCACGCCCTCGGATGTCAGCAGGAGGGTCGCTGTTTCCAGACGCGACTTGGGCTCCAAGAGCTTGCCGGTC
TACAACGCGACCCTGGCACCCGCGGGCCGGAAACGTCTGCCCGCCGTGGCCTCGGATGGCAACGGCACCGTCGTC
TTCGCGGGCGGTGGCCAGGACGGCGCGTTGCTCGTGTTCAACGGCAAGAAGAATACCTGGGTCGACGTCGGAGCC
ATGCTCGGCGACGGCAGCAAGGCTTTCCTGGCGCCGACGAGCGCGTCGCCCACGGAGACGCCCTCGAGCACGAGC
ACGTCGGGAGCGTCTACGTCGACGACGGCAGCCGGCAACCGGGGCAGGACCGGACCCGGGCCCAATGCCTTGCTG
GGCATCACCCTGGGCTGCATCCTCGGTCTGATGGCCCTCCTCGGTATCGTCCTTTTTCTCCTCCGGCGGCGCAAG
AAGCTCCGCAGACGCAAGGCGGCCGACGACGATTCGGAGGAGAAGGAAGCCGAGGACATGTCACCCAGCACGATA
CCTCCCAAGTCTCATTTCCGCGGTCATCACCCGCAAGCGTCTCACGAGTCCTATTCGTCCATGGCCATTCTGATG
GGTCGAGTCGGCAAGGATAGGGGCCTGACGCGCAAGACGAGCCACGACACGAACCGGAGCTCGGACAGCTCGCTG
CACAAGAAGTTCAAGAGCACCATCAGCAAGCCGATACCACAGCCGGCGGCCTACCCGGTGCTGCCGGGCCCATAT
GACGATGACAAGAACGCGAGCCTGGCGCCCAAGGCGGCGGCGGCGGTGGCGGCGGCGGCGGCGGCGGCCGAATCA
AATGACACGACGCGGAGGAGCTCCGGCTGGAACCGTTATTGGTCCGGGGGAAGCGCCCTTCAGATCCTGGGTCTG
GGGCCGACGCGGAGGAACACGACGATGTCGGAGCGGAGCTCGCACTACTCGGACAGCGGCAACCGGATGCGGCAG
GACTCGGCCACAGTACCGCCGCTGACGATGGACGGACGGCCAGAGGTCAACAGCGTGGCGGTCAACAGCCCGACT
GTGGCGCGGCTGGCGACGGCGGAGGGCATGGCGGGCCGGATCGTGCGGCCGACGTCTCCGGCGTCTTCGGGCTAC
TCGAGCGGCATCCCGGAGAGCGTCGTCGACGGCTGGGACACGGCTTCGGGCGGCGGTCGGGGTGGACATCGCCGG
GCGGGGTCCACGGCTCGAGCTACTACGCGGCCTCGGGCCGGGCCGTTCCTTCGGGGATGA
Gene >Ophcf2|00290
ATGTCCATCCCGGAGCCTCCGGCTTCGTTGGACGACGCATGCTTCGCAATACACAACGGCACCCTGTTTGCCTAC
TCGTCTCATGGCTTCTTTTCCTTAGTACTCGACAAGGGCGCCGCCTGGCGGAAGCTCGACATGGGCGTCCCCGTC
GAGGGCGCCCCCTGTCTGAGCACGACGCCTCTCGACGCCAGCCAGGCCGCCTTGTTCGTCGTCGGCGGCCGTACA
GACTCGGGCGACTACCCGGGCCTGCAAAGATATACATACGATGACGGCCAGTGGTCTACCATCCGCCTCACCGAC
GAGGTCACCAAGCAACGACTGGGTCACGCCGTAACCTACGTCGCCTCTGACGATGTCATTCTCATGTACGCCGGT
CATCAGGATGGCACCAATGGCCTCTCCTCTCAGACCTTTGCCATTCAGTCCTCCCATCCCTTTACCGTCCGCGGA
TACGAATCCGTCGCGCCCCCGGCCGACTCACCTGTTCTCTTTGCTTGGTCCGCCTCCGACGCTGGCATGCTCACG
GGAGGCAACGGTCCGCTCGACGATCGTCCCTGGCTATGGAACCCTTCATCCGGCTGGAGAAGCTGGGAGACGACA
ATATCGGCTCCTTTCAAGGTGACGCCGCTCACGCGCCTCGTCCCGGTCGATGGCGACGACGGGTCCAAGTTCCTC
TACGCCTTCGATTTTGGCCAATCTCCTGTAGCCGTCAGCGTCATGGTCCTGCAGGACGGCGCGGGTAACCCGGGC
CCCAGCACGCCCTCGGATGTCAGCAGGAGGGTCGCTGTTTCCAGACGCGACTTGGGCTCCAAGAGCTTGCCGGTC
TACAACGCGACCCTGGCACCCGCGGGCCGGAAACGTCTGCCCGCCGTGGCCTCGGATGGCAACGGCACCGTCGTC
TTCGCGGGCGGTGGCCAGGACGGCGCGTTGCTCGTGTTCAACGGCAAGAAGAATACCTGGGTCGACGTCGGAGCC
ATGCTCGGCGACGGCAGCAAGGCTTTCCTGGCGCCGACGAGCGCGTCGCCCACGGAGACGCCCTCGAGCACGAGC
ACGTCGGGAGCGTCTACGTCGACGACGGCAGCCGGCAACCGGGGCAGGACCGGACCCGGGCCCAATGCCTTGCTG
GGCATCACCCTGGGCTGCATCCTCGGTCTGATGGCCCTCCTCGGTATCGTCCTTTTTCTCCTCCGGCGGCGCAAG
AAGCTCCGCAGACGCAAGGCGGCCGACGACGATTCGGAGGAGAAGGAAGCCGAGGACATGTCACCCAGCACGATA
CCTCCCAAGTCTCATTTCCGCGGTCATCACCCGCAAGCGTCTCACGAGTCCTATTCGTCCATGGCCATTCTGATG
GGTCGAGTCGGCAAGGATAGGGGCCTGACGCGCAAGACGAGCCACGACACGAACCGGAGCTCGGACAGCTCGCTG
CACAAGAAGTTCAAGAGCACCATCAGCAAGCCGATACCACAGCCGGCGGCCTACCCGGTGCTGCCGGGCCCATAT
GACGATGACAAGAACGCGAGCCTGGCGCCCAAGGCGGCGGCGGCGGTGGCGGCGGCGGCGGCGGCGGCCGAATCA
AATGACACGACGCGGAGGAGCTCCGGCTGGAACCGTTATTGGTCCGGGGGAAGCGCCCTTCAGATCCTGGGTCTG
GGGCCGACGCGGAGGAACACGACGATGTCGGAGCGGAGCTCGCACTACTCGGACAGCGGCAACCGGATGCGGCAG
GACTCGGCCACAGTACCGCCGCTGACGATGGACGGACGGCCAGAGGTCAACAGCGTGGCGGTCAACAGCCCGACT
GTGGCGCGGCTGGCGACGGCGGAGGGCATGGCGGGCCGGATCGTGCGGCCGACGTCTCCGGCGTCTTCGGGCTAC
TCGAGCGGCATCCCGGAGAGCGTCGTCGACGGCTGGGACACGGCTTCGGGCGGCGGTCGGGGTGGACATCGCCGG
GCGGGGTCCACGGCTCGAGCTACTACGCGGCCTCGGGCCGGGCCGTTCCTTCGGGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail