Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00289
Gene name
Locationscaffold_01:1383678..1385374
Strand+
Gene length (bp)1696
Transcript length (bp)1488
Coding sequence length (bp)1488
Protein length (aa) 496

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03943 TAP_C TAP C-terminal domain 1.6E-16 444 489
PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain 4.6E-05 249 420

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0051028 mRNA transport Yes
GO:0043226 organelle No
GO:0050657 nucleic acid transport No
GO:0051234 establishment of localization No
GO:0015931 nucleobase-containing compound transport No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0043229 intracellular organelle No
GO:0008150 biological_process No
GO:0051236 establishment of RNA localization No
GO:0071705 nitrogen compound transport No
GO:0050658 RNA transport No
GO:0071702 organic substance transport No
GO:0043227 membrane-bounded organelle No
GO:0051179 localization No
GO:0043231 intracellular membrane-bounded organelle No
GO:0005575 cellular_component No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.7045 0.5313 0.1116 0.1423 0.0747 0.004 0.2308 0.1665 0.0975 0.0098

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup997
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3750
Ophiocordyceps australis map64 (Brazil) OphauB2|4325
Ophiocordyceps camponoti-floridani Ophcf2|00289 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5074
Ophiocordyceps kimflemingae Ophio5|7391
Ophiocordyceps subramaniannii Hirsu2|8385
Ophiocordyceps subramaniannii Hirsu2|8564

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00289
MIKKSHAAGDYVFIGASQEDADEIIKLNTFTFAGIQLEIVESDDSLEYHGKATESKDTQELRAKLQAILGQRYQG
ANKLLKLDALASDPELVTLGMFENRERALKTFKGLMAICDGLFKTAVEKREAIESISIANNSIDDISQVESLATT
FPQLKNLDISGNQLSNMKTLDPWKGKFRELETIYVTGNPLENLDASYQTTLLDWFPNLQNINGSQVRTAEQIAQQ
RAAGSRSKAIPQSGPDFRDVNGIGENFLLEFFAAFDHDRQGLSSRFYDEASKFSLAVDTRSARRESTPAPLPWSA
YIKVSRNLMKITTVNARTQRLFKGVDVIADVWKSLPLTKHPNIKEDLSKYIMDCHPLSGLGDPNGQTRTGVDGLI
ISVHGEFEELDQKSGERGQRSFSRTFVLGPGQAGKGPIRVVSDMLSLRAYNPLPNVFAQTTANNAHQAMVDELSK
QTGMVSEYCEMCLSQVDWQFDKAIAMFHEKKAALPTEAFSSVSRC*
Coding >Ophcf2|00289
ATGATCAAAAAGTCCCACGCGGCCGGCGACTATGTATTCATCGGCGCCAGCCAGGAAGACGCGGATGAGATCATC
AAGCTCAACACTTTCACATTTGCCGGTATCCAACTGGAGATTGTCGAGTCTGACGACAGCCTCGAGTATCACGGC
AAAGCCACGGAGTCCAAGGATACGCAGGAGCTGCGGGCCAAACTCCAAGCCATCCTGGGCCAGCGATACCAGGGC
GCCAACAAGCTGCTAAAGCTGGACGCTCTCGCCTCCGACCCGGAGCTCGTCACGCTCGGCATGTTTGAGAACCGA
GAGAGGGCCCTCAAGACGTTCAAGGGACTCATGGCCATATGCGACGGCCTCTTCAAGACGGCTGTGGAAAAACGC
GAGGCGATTGAGAGCATCAGCATCGCCAACAACAGCATCGACGACATCTCTCAGGTCGAGTCACTGGCCACGACG
TTTCCGCAGCTGAAGAACCTCGACATCAGCGGCAACCAGTTGAGCAACATGAAAACGCTGGACCCGTGGAAGGGC
AAGTTTAGGGAACTCGAGACCATCTACGTGACGGGGAACCCGCTGGAGAACTTGGACGCCAGCTACCAGACGACG
CTCCTCGACTGGTTCCCCAATCTGCAAAACATCAACGGCAGCCAAGTCCGAACGGCCGAGCAGATAGCCCAACAG
CGAGCTGCCGGGTCGAGGTCCAAGGCCATACCGCAGAGCGGACCCGACTTCCGCGACGTTAACGGCATCGGGGAG
AATTTTCTGCTCGAATTCTTTGCGGCTTTCGATCACGACCGACAAGGCCTGTCGTCTCGCTTCTACGATGAGGCC
AGTAAGTTTTCCCTCGCCGTGGATACGCGATCAGCACGAAGGGAAAGCACGCCGGCGCCGCTTCCATGGTCGGCA
TACATCAAGGTGTCGCGGAACCTGATGAAGATTACGACGGTGAATGCGAGGACACAGAGGCTTTTCAAGGGGGTC
GACGTCATCGCCGACGTCTGGAAGAGCCTCCCCCTCACCAAGCATCCCAACATCAAAGAGGACCTCAGCAAATAC
ATCATGGACTGTCATCCGCTGTCGGGTCTAGGGGATCCCAACGGACAGACGCGCACGGGCGTGGACGGACTGATC
ATCTCGGTGCACGGCGAATTCGAGGAGCTCGACCAGAAGAGCGGGGAACGAGGACAGCGCAGTTTCTCGCGCACC
TTTGTGCTCGGGCCTGGCCAGGCCGGCAAGGGGCCGATCCGGGTTGTTAGCGACATGCTGTCCCTCAGAGCCTAC
AACCCGCTGCCCAACGTATTCGCGCAGACGACGGCAAACAACGCACACCAGGCCATGGTTGACGAGCTGTCGAAG
CAAACGGGCATGGTGAGCGAGTACTGCGAGATGTGTCTCTCGCAGGTGGACTGGCAGTTTGACAAGGCCATTGCC
ATGTTCCACGAGAAAAAGGCGGCGCTTCCCACGGAGGCCTTTTCGTCGGTGTCTCGGTGTTAG
Transcript >Ophcf2|00289
ATGATCAAAAAGTCCCACGCGGCCGGCGACTATGTATTCATCGGCGCCAGCCAGGAAGACGCGGATGAGATCATC
AAGCTCAACACTTTCACATTTGCCGGTATCCAACTGGAGATTGTCGAGTCTGACGACAGCCTCGAGTATCACGGC
AAAGCCACGGAGTCCAAGGATACGCAGGAGCTGCGGGCCAAACTCCAAGCCATCCTGGGCCAGCGATACCAGGGC
GCCAACAAGCTGCTAAAGCTGGACGCTCTCGCCTCCGACCCGGAGCTCGTCACGCTCGGCATGTTTGAGAACCGA
GAGAGGGCCCTCAAGACGTTCAAGGGACTCATGGCCATATGCGACGGCCTCTTCAAGACGGCTGTGGAAAAACGC
GAGGCGATTGAGAGCATCAGCATCGCCAACAACAGCATCGACGACATCTCTCAGGTCGAGTCACTGGCCACGACG
TTTCCGCAGCTGAAGAACCTCGACATCAGCGGCAACCAGTTGAGCAACATGAAAACGCTGGACCCGTGGAAGGGC
AAGTTTAGGGAACTCGAGACCATCTACGTGACGGGGAACCCGCTGGAGAACTTGGACGCCAGCTACCAGACGACG
CTCCTCGACTGGTTCCCCAATCTGCAAAACATCAACGGCAGCCAAGTCCGAACGGCCGAGCAGATAGCCCAACAG
CGAGCTGCCGGGTCGAGGTCCAAGGCCATACCGCAGAGCGGACCCGACTTCCGCGACGTTAACGGCATCGGGGAG
AATTTTCTGCTCGAATTCTTTGCGGCTTTCGATCACGACCGACAAGGCCTGTCGTCTCGCTTCTACGATGAGGCC
AGTAAGTTTTCCCTCGCCGTGGATACGCGATCAGCACGAAGGGAAAGCACGCCGGCGCCGCTTCCATGGTCGGCA
TACATCAAGGTGTCGCGGAACCTGATGAAGATTACGACGGTGAATGCGAGGACACAGAGGCTTTTCAAGGGGGTC
GACGTCATCGCCGACGTCTGGAAGAGCCTCCCCCTCACCAAGCATCCCAACATCAAAGAGGACCTCAGCAAATAC
ATCATGGACTGTCATCCGCTGTCGGGTCTAGGGGATCCCAACGGACAGACGCGCACGGGCGTGGACGGACTGATC
ATCTCGGTGCACGGCGAATTCGAGGAGCTCGACCAGAAGAGCGGGGAACGAGGACAGCGCAGTTTCTCGCGCACC
TTTGTGCTCGGGCCTGGCCAGGCCGGCAAGGGGCCGATCCGGGTTGTTAGCGACATGCTGTCCCTCAGAGCCTAC
AACCCGCTGCCCAACGTATTCGCGCAGACGACGGCAAACAACGCACACCAGGCCATGGTTGACGAGCTGTCGAAG
CAAACGGGCATGGTGAGCGAGTACTGCGAGATGTGTCTCTCGCAGGTGGACTGGCAGTTTGACAAGGCCATTGCC
ATGTTCCACGAGAAAAAGGCGGCGCTTCCCACGGAGGCCTTTTCGTCGGTGTCTCGGTGTTAG
Gene >Ophcf2|00289
ATGATCAAAAAGGTTAGTCCTTACTCGATGGCGGCTCCCGAATGTCAGCAAAAGTTTTTCAAAGATCGGCTCGTC
TATGTCCAAGAGAGAGCGCTCAGCCTAGCGTCTTGTTTCGTCACTTCAATAATCGGCTTCAAGCTGACGGGCGGC
AGTCCCACGCGGCCGGCGACTATGTATTCATCGGCGCCAGCCAGGAAGACGCGGATGAGATCATCAAGCTCAACA
CTTTCACATTTGCCGGTATCCAACTGGAGATTGTCGAGTCTGACGACAGCCTCGAGTATCACGGCAAAGCCACGG
AGTCCAAGGATACGCAGGAGCTGCGGGCCAAACTCCAAGCCATCCTGGGCCAGCGATACCAGGGCGCCAACAAGC
TGCTAAAGCTGGACGCTCTCGCCTCCGACCCGGAGCTCGTCACGCTCGGCATGTTTGAGAACCGAGAGAGGGCCC
TCAAGACGTTCAAGGGACTCATGGCCATATGCGACGGCCTCTTCAAGACGGCTGTGGAAAAACGCGAGGCGATTG
AGAGCATCAGCATCGCCAACAACAGCATCGACGACATCTCTCAGGTCGAGTCACTGGCCACGACGTTTCCGCAGC
TGAAGAACCTCGACATCAGCGGCAACCAGTTGAGCAACATGAAAACGCTGGACCCGTGGAAGGGCAAGTTTAGGG
AACTCGAGACCATCTACGTGACGGGGAACCCGCTGGAGAACTTGGACGCCAGCTACCAGACGACGCTCCTCGACT
GGTTCCCCAATCTGCAAAACATCAACGGCAGCCAAGTCCGAACGGCCGAGCAGATAGCCCAACAGCGAGCTGCCG
GGTCGAGGTCCAAGGCCATACCGCAGAGCGGACCCGACTTCCGCGACGTTAACGGCATCGGGGAGAATTTTCTGC
TCGAATTCTTTGCGGCTTTCGATCACGACCGACAAGGCCTGTCGTCTCGCTTCTACGATGAGGCCAGTAAGTTTT
CCCTCGCCGTGGATACGCGATCAGCACGAAGGGAAAGCACGCCGGCGCCGCTTCCATGGTCGGCATACATCAAGG
TGTCGCGGAACCTGATGAAGATTACGACGGTGAATGCGAGGACACAGAGGCTTTTCAAGGGGGTCGACGTCATCG
CCGACGTCTGGAAGAGCCTCCCCCTCACCAAGCATCCCAACATCAAAGAGGACCTCAGCAAATACATCATGGACT
GTCATCCGCTGTCGGGTCTAGGGGATCCCAACGGACAGACGCGCACGGGCGTGGACGGACTGATCATCTCGGTGC
ACGGCGAATTCGAGGAGCTCGACCAGAAGAGCGGGGAACGAGGACAGCGCAGTTTCTCGCGCACCTTTGTGCTCG
GGCCTGGCCAGGCCGGCAAGGGGCCGATCCGGGTTGTTAGCGACATGCTGTCCCTCAGAGCCTACAACCCGCTGC
CCAACGTATTCGCGCAGACGACGGCAAACAACGCACACCAGGCCATGGTTGACGAGCTGTCGAAGCAAACGGGCA
TGGTGAGCGAGTACTGCGAGATGTGTCTCTCGCAGGTGGACTGGCAGTTTGACAAGGCCATTGCCATGTTCCACG
AGAAAAAGGTACGGGGGAGGATCGATGATCGGGAGGCGTTGTTGAGGCGTTGTTGGTTGCTGACGGACCGGAGCA
GGCGGCGCTTCCCACGGAGGCCTTTTCGTCGGTGTCTCGGTGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail