Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00282
Gene name
Locationscaffold_01:1364098..1365333
Strand+
Gene length (bp)1235
Transcript length (bp)1104
Coding sequence length (bp)1104
Protein length (aa) 368

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase 3.4E-20 28 171
PF03351 DOMON DOMON domain 7.2E-09 29 118

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 197 219 22
2 229 251 22
3 301 323 22
4 328 350 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00282
MMRLITTAVAFGATIVSSATAPFCPEPRVCFRWAIPNNSQDVMFQLQAPTTYRWVGLGIGSQMRGADMFVVYASG
SDNVTLSTRRGTGHAPPQPAERSDVVLDEGSGISDGVMTANVRCSGCDSLNLDGSNEWIAAWQQGAAINSRSTSA
PIAKHDGFNSFSVDMAQARGANNRAPFFGSDGSSSGVGVGRRQGPRLGFAHGVLMSVLFIFGFPVGSMLMPLVGN
WIVHAVWQMVTFLAMWAGFGLGYYVAQRRGILFAGPHTTLGTCVCALMCLQPMLGYAHHLYFLKYRARGPISYAH
IWYGRSLMILGLVNGGLGLALTGLPRTFVIVYIVLAIVFSLLYVGVSVVSTIRKMRGPGRKLRAESL*
Coding >Ophcf2|00282
ATGATGCGACTCATAACCACGGCTGTCGCCTTCGGCGCGACCATAGTATCCAGTGCTACGGCACCGTTCTGTCCA
GAGCCGCGCGTCTGCTTCCGATGGGCGATTCCGAACAACAGCCAAGATGTAATGTTCCAGCTTCAGGCGCCGACG
ACGTACAGATGGGTCGGCCTCGGCATCGGCTCGCAGATGCGCGGCGCGGACATGTTCGTCGTCTACGCGTCGGGA
TCGGACAACGTGACGCTCAGCACCCGGCGCGGCACCGGCCACGCACCTCCGCAGCCGGCCGAGAGGTCCGATGTC
GTACTCGACGAGGGTTCCGGCATCAGCGACGGCGTCATGACGGCAAACGTCCGCTGCAGTGGTTGCGACTCCCTC
AACCTTGACGGGTCCAACGAATGGATTGCCGCGTGGCAGCAGGGCGCTGCCATCAACTCGAGGAGCACGTCGGCT
CCCATCGCCAAACACGATGGCTTCAATAGCTTCTCGGTCGACATGGCCCAGGCTCGGGGCGCAAACAACCGTGCG
CCCTTTTTCGGATCGGACGGATCGTCATCTGGCGTCGGCGTCGGTAGGCGTCAGGGCCCGAGGCTGGGCTTCGCT
CACGGCGTGCTCATGTCGGTGCTCTTCATCTTTGGATTCCCTGTTGGGTCGATGCTCATGCCGCTCGTCGGAAAC
TGGATCGTGCATGCCGTCTGGCAGATGGTGACGTTTCTAGCCATGTGGGCTGGCTTCGGGCTGGGATACTACGTC
GCCCAACGACGAGGCATACTCTTTGCCGGTCCTCACACGACGCTGGGGACGTGCGTATGCGCCCTCATGTGCCTA
CAACCCATGCTCGGATACGCGCACCACCTATACTTTCTCAAATATCGAGCCCGCGGCCCCATCAGCTACGCGCAC
ATCTGGTACGGCCGAAGCCTGATGATCCTGGGTCTCGTCAACGGCGGCCTGGGCCTCGCGCTGACCGGCCTCCCG
CGGACCTTTGTCATCGTCTACATTGTACTGGCCATTGTCTTCTCCCTGCTGTACGTGGGCGTCAGCGTCGTCAGT
ACCATCAGGAAGATGCGCGGGCCGGGGCGCAAGTTGCGGGCCGAGTCCCTGTGA
Transcript >Ophcf2|00282
ATGATGCGACTCATAACCACGGCTGTCGCCTTCGGCGCGACCATAGTATCCAGTGCTACGGCACCGTTCTGTCCA
GAGCCGCGCGTCTGCTTCCGATGGGCGATTCCGAACAACAGCCAAGATGTAATGTTCCAGCTTCAGGCGCCGACG
ACGTACAGATGGGTCGGCCTCGGCATCGGCTCGCAGATGCGCGGCGCGGACATGTTCGTCGTCTACGCGTCGGGA
TCGGACAACGTGACGCTCAGCACCCGGCGCGGCACCGGCCACGCACCTCCGCAGCCGGCCGAGAGGTCCGATGTC
GTACTCGACGAGGGTTCCGGCATCAGCGACGGCGTCATGACGGCAAACGTCCGCTGCAGTGGTTGCGACTCCCTC
AACCTTGACGGGTCCAACGAATGGATTGCCGCGTGGCAGCAGGGCGCTGCCATCAACTCGAGGAGCACGTCGGCT
CCCATCGCCAAACACGATGGCTTCAATAGCTTCTCGGTCGACATGGCCCAGGCTCGGGGCGCAAACAACCGTGCG
CCCTTTTTCGGATCGGACGGATCGTCATCTGGCGTCGGCGTCGGTAGGCGTCAGGGCCCGAGGCTGGGCTTCGCT
CACGGCGTGCTCATGTCGGTGCTCTTCATCTTTGGATTCCCTGTTGGGTCGATGCTCATGCCGCTCGTCGGAAAC
TGGATCGTGCATGCCGTCTGGCAGATGGTGACGTTTCTAGCCATGTGGGCTGGCTTCGGGCTGGGATACTACGTC
GCCCAACGACGAGGCATACTCTTTGCCGGTCCTCACACGACGCTGGGGACGTGCGTATGCGCCCTCATGTGCCTA
CAACCCATGCTCGGATACGCGCACCACCTATACTTTCTCAAATATCGAGCCCGCGGCCCCATCAGCTACGCGCAC
ATCTGGTACGGCCGAAGCCTGATGATCCTGGGTCTCGTCAACGGCGGCCTGGGCCTCGCGCTGACCGGCCTCCCG
CGGACCTTTGTCATCGTCTACATTGTACTGGCCATTGTCTTCTCCCTGCTGTACGTGGGCGTCAGCGTCGTCAGT
ACCATCAGGAAGATGCGCGGGCCGGGGCGCAAGTTGCGGGCCGAGTCCCTGTGA
Gene >Ophcf2|00282
ATGATGCGACTCATAACCACGGCTGTCGCCTTCGGTAAGTCCATGTCTGCTACACTCTCTAGTCCTCTACTGACA
AACATGTCTCCCCCCAACCTCCCCAGGCGCGACCATAGTATCCAGTGCTACGGCACCGTTCTGTCCAGAGCCGCG
CGTCTGCTTCCGATGGGCGATTCCGAACAACAGCCAAGATGTAATGTTCCAGCTTCAGGCGCCGACGACGTACAG
ATGGGTCGGCCTCGGCATCGGCTCGCAGATGCGCGGCGCGGACATGTTCGTCGTCTACGCGTCGGGATCGGACAA
CGTGACGCTCAGCACCCGGCGCGGCACCGGCCACGCACCTCCGCAGCCGGCCGAGAGGTCCGATGTCGTACTCGA
CGAGGGTTCCGGCATCAGCGACGGCGTCATGACGGCAAACGTCCGCTGCAGTGGTTGCGACTCCCTCAACCTTGA
CGGGTCCAACGAATGGATTGCCGCGTGGCAGCAGGGCGCTGCCATCAACTCGAGGAGCACGTCGGCTCCCATCGC
CAAACACGATGGCTTCAATAGCTTCTCGGTCGACATGGCCCAGGCTCGGGGCGCAAACAACCGTGCGCCCTTTTT
CGGATCGGACGGATCGTCATCTGGCGTCGGCGTCGGTAGGCGTCAGGGCCCGAGGCTGGGCTTCGCTCACGGCGT
GCTCATGTCGGTGCTCTTCATCTTTGGATTCCCTGTTGGGTCGATGCTCATGCCGCTCGTCGGAAACTGGATCGT
GCATGCCGTCTGGCAGATGGTGACGTTTCTAGCCATGTGGGCTGGCTTCGGGCTGGGATACTACGTCGCCCAACG
ACGAGGCATAGTCAGTCTAGCTCGCTCATCTTCCCCTCTTCCCCTCTTGGTCTCGCGCTAACAAACCTGACCAGC
TCTTTGCCGGTCCTCACACGACGCTGGGGACGTGCGTATGCGCCCTCATGTGCCTACAACCCATGCTCGGATACG
CGCACCACCTATACTTTCTCAAATATCGAGCCCGCGGCCCCATCAGCTACGCGCACATCTGGTACGGCCGAAGCC
TGATGATCCTGGGTCTCGTCAACGGCGGCCTGGGCCTCGCGCTGACCGGCCTCCCGCGGACCTTTGTCATCGTCT
ACATTGTACTGGCCATTGTCTTCTCCCTGCTGTACGTGGGCGTCAGCGTCGTCAGTACCATCAGGAAGATGCGCG
GGCCGGGGCGCAAGTTGCGGGCCGAGTCCCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail