Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00274
Gene name
Locationscaffold_01:1343658..1345065
Strand-
Gene length (bp)1407
Transcript length (bp)1407
Coding sequence length (bp)1407
Protein length (aa) 469

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 148.65 81.49 215.81
Alive In ants, during behavior modification 181.14 96.64 265.65
Dead In ants, recently dead 163.40 88.71 238.09

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.361479 no
Alive Dead 0.600996 no
Dead Fungus 0.685287 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00274
MADGTMSYLYTVGGYATLIGVGYALYHVSTHKANRRAATSASRGGKTPHQEPRKEDRKKKQRMESFASDTQEAAK
AKARGKPVDEPNIQPKTTTRDASEEDDNREFARQLAKAQEGTKLASKTDGTKQREKSVKQSRANQASAKGDAPKV
TESKVAVDDGDKATAEKATPDKVSAPLSTTAAAAPAEKSSAPSSTAGGDADDDRSPPSSPAAGPTDVSGVSDMLE
PAPAAPSVLRITDSGTTQKPKQKAVKAPEKVETKKQRQNRKKAEAAKAAREAAEKERKVLEEKQRRAARIAEGRP
AKDGSQFMAGEGARSAWAHGATNGSGGKASDAAALDGPLDTFGKPATMAPARQASPTGQQSHSGVKSDSSWISSL
PSEEEQMEMLKDEADDWNTVKTKSKKAVKKVSSGSSADEAAPAPTKQPAAAAAASTARPTKTPAPSNFGGSFSAL
TRADERIEISDIEEEWDV*
Coding >Ophcf2|00274
ATGGCTGACGGCACCATGAGCTATCTCTATACCGTCGGTGGCTATGCCACCCTCATTGGAGTCGGTTATGCTCTC
TACCACGTCTCTACCCACAAGGCAAATCGACGGGCCGCCACCTCGGCCTCTCGCGGTGGCAAGACGCCTCATCAA
GAGCCGCGCAAAGAGGACAGAAAGAAAAAGCAGAGGATGGAGAGCTTCGCATCCGATACTCAGGAGGCCGCCAAA
GCAAAGGCCCGCGGCAAGCCGGTCGACGAGCCCAATATTCAGCCCAAAACGACTACCCGCGACGCGTCGGAAGAG
GACGACAACCGCGAATTTGCCAGGCAGCTGGCCAAGGCCCAAGAAGGCACTAAGCTGGCCAGCAAGACCGACGGC
ACCAAGCAGCGCGAGAAGTCGGTCAAACAGTCTCGCGCCAACCAGGCATCGGCCAAGGGCGACGCTCCCAAGGTT
ACCGAGTCCAAGGTTGCTGTCGACGATGGCGACAAGGCCACTGCCGAAAAGGCTACCCCTGACAAGGTGTCGGCT
CCTTTGTCTACGACGGCTGCTGCGGCTCCTGCCGAGAAAAGCTCAGCTCCCTCGTCGACGGCAGGTGGTGACGCC
GACGACGACCGGTCTCCCCCTTCGTCTCCCGCAGCCGGTCCTACCGACGTCAGCGGCGTCAGCGACATGCTGGAG
CCCGCCCCTGCTGCCCCCTCGGTCTTGCGCATTACCGACTCGGGCACCACCCAGAAGCCCAAGCAGAAGGCTGTC
AAGGCTCCCGAAAAGGTCGAGACCAAGAAGCAGCGTCAGAACCGCAAGAAGGCCGAGGCGGCCAAGGCGGCTCGC
GAAGCGGCCGAGAAGGAACGCAAGGTTCTAGAGGAGAAGCAGCGACGGGCTGCCCGTATCGCCGAAGGACGCCCT
GCCAAGGACGGCTCCCAGTTCATGGCCGGCGAGGGTGCCCGTTCCGCCTGGGCGCACGGAGCCACCAACGGCAGC
GGCGGTAAGGCGTCCGATGCCGCTGCCCTTGACGGGCCGCTGGACACTTTTGGGAAGCCGGCAACTATGGCGCCC
GCTCGGCAGGCGTCGCCCACAGGCCAGCAGTCTCATTCCGGCGTCAAGTCGGACAGCTCTTGGATCTCGTCTCTC
CCGTCGGAGGAGGAGCAGATGGAGATGCTCAAGGACGAGGCCGACGACTGGAACACGGTCAAGACCAAATCCAAG
AAGGCCGTCAAGAAGGTCTCGTCCGGCTCCTCGGCGGACGAGGCGGCACCGGCTCCGACCAAGCAACCCGCGGCG
GCGGCGGCGGCTTCCACCGCGAGGCCGACCAAGACGCCAGCCCCCTCCAACTTTGGCGGCTCATTTTCGGCCCTA
ACGAGGGCGGACGAGCGGATCGAGATTTCCGACATTGAAGAGGAGTGGGACGTGTGA
Transcript >Ophcf2|00274
ATGGCTGACGGCACCATGAGCTATCTCTATACCGTCGGTGGCTATGCCACCCTCATTGGAGTCGGTTATGCTCTC
TACCACGTCTCTACCCACAAGGCAAATCGACGGGCCGCCACCTCGGCCTCTCGCGGTGGCAAGACGCCTCATCAA
GAGCCGCGCAAAGAGGACAGAAAGAAAAAGCAGAGGATGGAGAGCTTCGCATCCGATACTCAGGAGGCCGCCAAA
GCAAAGGCCCGCGGCAAGCCGGTCGACGAGCCCAATATTCAGCCCAAAACGACTACCCGCGACGCGTCGGAAGAG
GACGACAACCGCGAATTTGCCAGGCAGCTGGCCAAGGCCCAAGAAGGCACTAAGCTGGCCAGCAAGACCGACGGC
ACCAAGCAGCGCGAGAAGTCGGTCAAACAGTCTCGCGCCAACCAGGCATCGGCCAAGGGCGACGCTCCCAAGGTT
ACCGAGTCCAAGGTTGCTGTCGACGATGGCGACAAGGCCACTGCCGAAAAGGCTACCCCTGACAAGGTGTCGGCT
CCTTTGTCTACGACGGCTGCTGCGGCTCCTGCCGAGAAAAGCTCAGCTCCCTCGTCGACGGCAGGTGGTGACGCC
GACGACGACCGGTCTCCCCCTTCGTCTCCCGCAGCCGGTCCTACCGACGTCAGCGGCGTCAGCGACATGCTGGAG
CCCGCCCCTGCTGCCCCCTCGGTCTTGCGCATTACCGACTCGGGCACCACCCAGAAGCCCAAGCAGAAGGCTGTC
AAGGCTCCCGAAAAGGTCGAGACCAAGAAGCAGCGTCAGAACCGCAAGAAGGCCGAGGCGGCCAAGGCGGCTCGC
GAAGCGGCCGAGAAGGAACGCAAGGTTCTAGAGGAGAAGCAGCGACGGGCTGCCCGTATCGCCGAAGGACGCCCT
GCCAAGGACGGCTCCCAGTTCATGGCCGGCGAGGGTGCCCGTTCCGCCTGGGCGCACGGAGCCACCAACGGCAGC
GGCGGTAAGGCGTCCGATGCCGCTGCCCTTGACGGGCCGCTGGACACTTTTGGGAAGCCGGCAACTATGGCGCCC
GCTCGGCAGGCGTCGCCCACAGGCCAGCAGTCTCATTCCGGCGTCAAGTCGGACAGCTCTTGGATCTCGTCTCTC
CCGTCGGAGGAGGAGCAGATGGAGATGCTCAAGGACGAGGCCGACGACTGGAACACGGTCAAGACCAAATCCAAG
AAGGCCGTCAAGAAGGTCTCGTCCGGCTCCTCGGCGGACGAGGCGGCACCGGCTCCGACCAAGCAACCCGCGGCG
GCGGCGGCGGCTTCCACCGCGAGGCCGACCAAGACGCCAGCCCCCTCCAACTTTGGCGGCTCATTTTCGGCCCTA
ACGAGGGCGGACGAGCGGATCGAGATTTCCGACATTGAAGAGGAGTGGGACGTGTGA
Gene >Ophcf2|00274
ATGGCTGACGGCACCATGAGCTATCTCTATACCGTCGGTGGCTATGCCACCCTCATTGGAGTCGGTTATGCTCTC
TACCACGTCTCTACCCACAAGGCAAATCGACGGGCCGCCACCTCGGCCTCTCGCGGTGGCAAGACGCCTCATCAA
GAGCCGCGCAAAGAGGACAGAAAGAAAAAGCAGAGGATGGAGAGCTTCGCATCCGATACTCAGGAGGCCGCCAAA
GCAAAGGCCCGCGGCAAGCCGGTCGACGAGCCCAATATTCAGCCCAAAACGACTACCCGCGACGCGTCGGAAGAG
GACGACAACCGCGAATTTGCCAGGCAGCTGGCCAAGGCCCAAGAAGGCACTAAGCTGGCCAGCAAGACCGACGGC
ACCAAGCAGCGCGAGAAGTCGGTCAAACAGTCTCGCGCCAACCAGGCATCGGCCAAGGGCGACGCTCCCAAGGTT
ACCGAGTCCAAGGTTGCTGTCGACGATGGCGACAAGGCCACTGCCGAAAAGGCTACCCCTGACAAGGTGTCGGCT
CCTTTGTCTACGACGGCTGCTGCGGCTCCTGCCGAGAAAAGCTCAGCTCCCTCGTCGACGGCAGGTGGTGACGCC
GACGACGACCGGTCTCCCCCTTCGTCTCCCGCAGCCGGTCCTACCGACGTCAGCGGCGTCAGCGACATGCTGGAG
CCCGCCCCTGCTGCCCCCTCGGTCTTGCGCATTACCGACTCGGGCACCACCCAGAAGCCCAAGCAGAAGGCTGTC
AAGGCTCCCGAAAAGGTCGAGACCAAGAAGCAGCGTCAGAACCGCAAGAAGGCCGAGGCGGCCAAGGCGGCTCGC
GAAGCGGCCGAGAAGGAACGCAAGGTTCTAGAGGAGAAGCAGCGACGGGCTGCCCGTATCGCCGAAGGACGCCCT
GCCAAGGACGGCTCCCAGTTCATGGCCGGCGAGGGTGCCCGTTCCGCCTGGGCGCACGGAGCCACCAACGGCAGC
GGCGGTAAGGCGTCCGATGCCGCTGCCCTTGACGGGCCGCTGGACACTTTTGGGAAGCCGGCAACTATGGCGCCC
GCTCGGCAGGCGTCGCCCACAGGCCAGCAGTCTCATTCCGGCGTCAAGTCGGACAGCTCTTGGATCTCGTCTCTC
CCGTCGGAGGAGGAGCAGATGGAGATGCTCAAGGACGAGGCCGACGACTGGAACACGGTCAAGACCAAATCCAAG
AAGGCCGTCAAGAAGGTCTCGTCCGGCTCCTCGGCGGACGAGGCGGCACCGGCTCCGACCAAGCAACCCGCGGCG
GCGGCGGCGGCTTCCACCGCGAGGCCGACCAAGACGCCAGCCCCCTCCAACTTTGGCGGCTCATTTTCGGCCCTA
ACGAGGGCGGACGAGCGGATCGAGATTTCCGACATTGAAGAGGAGTGGGACGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail