Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00271
Gene name
Locationscaffold_01:1336963..1338628
Strand-
Gene length (bp)1665
Transcript length (bp)1665
Coding sequence length (bp)1665
Protein length (aa) 555

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01694 Rhomboid Rhomboid family 1.2E-23 380 525

GO

GO Term Description Terminal node
GO:0004252 serine-type endopeptidase activity Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0031224 intrinsic component of membrane No
GO:0004175 endopeptidase activity No
GO:0008236 serine-type peptidase activity No
GO:0003674 molecular_function No
GO:0017171 serine hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0016787 hydrolase activity No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 300 322 22
2 337 359 22
3 380 402 22
4 417 436 19
5 441 463 22
6 478 497 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00271
MASLLCPRVSRVLLSPVSSSSFSWTMLLQAPCLPSRRRDEALRPRTRQQPQQQQISRRSLWSLTKKGERVVIRYE
ELPRDYRDSRGLAFWRRDLYLGEVRRIFGPDMDTDEGNRLLRILHGRRVAGTLEDPALSVHTARFTAQQLADGLA
YLRKTVSVDEVLSAGLRAEDELKLMELEAEKKKPVEKQEAADKEEVREEETTTDGVYKPDPVYGRSILDEIRARN
IAKRKAREKALEEERQAARTALGDGSVDVVPVTDGDSSRALSDRPREFRSAKLAKYYEEAQSPLKEPPRMTAWQR
IMPSAAVALLTVGLLVGVCAVYEEPTAQYRLFREISASQATLATLVAINVAVFACWRVPPLWKTFNKYMILVVGK
PRAAAVLTSVFSHISLVHLVLNMVPLWFVGTRLHDDLDRAEFLTLYVGCGVMGFLSSLVAYTMRGMLVVSTLGSS
GATLGVLSAYLWEARREGFRMFGLPREGVHGVVLLGLLTAVQLGGLCRASKYKVDFVSHLMGMATGVAGMELIIR
KREAAAAAARRNLGKPRPVEVERGTALKR*
Coding >Ophcf2|00271
ATGGCCAGCCTGTTGTGTCCTCGGGTCTCGCGCGTCCTTCTGAGTCCCGTCTCAAGCAGCAGCTTCTCATGGACG
ATGCTGCTGCAGGCGCCGTGCCTCCCCTCTCGGCGTCGAGACGAGGCTCTGCGGCCTAGGACGCGGCAGCAGCCG
CAGCAGCAGCAGATCAGCCGACGGAGCCTATGGTCGCTGACGAAAAAGGGCGAGCGCGTCGTCATCAGATACGAG
GAGCTGCCGCGTGACTACCGTGACAGCAGGGGCCTCGCCTTCTGGCGCAGAGACCTGTATCTGGGCGAGGTCAGG
AGGATCTTTGGGCCGGACATGGACACGGACGAGGGAAATCGGCTTCTACGCATTCTTCACGGTCGAAGGGTAGCA
GGAACTCTCGAAGACCCGGCTTTGTCTGTTCACACGGCCCGCTTCACGGCACAGCAACTGGCCGACGGGCTGGCG
TACCTGAGAAAGACGGTGTCGGTGGACGAGGTGTTGAGTGCGGGGCTGAGGGCCGAGGATGAGCTGAAGCTCATG
GAACTGGAGGCGGAGAAGAAGAAGCCCGTCGAGAAGCAAGAGGCGGCCGACAAGGAAGAGGTCCGAGAAGAGGAG
ACGACGACAGATGGCGTTTACAAGCCCGATCCGGTTTACGGCCGAAGCATCCTGGACGAGATCCGAGCGCGCAAC
ATTGCCAAGCGAAAGGCGCGGGAAAAGGCGCTCGAGGAGGAGCGACAGGCAGCGCGGACGGCACTCGGCGACGGC
AGCGTGGACGTCGTCCCGGTGACGGATGGCGACTCGTCACGCGCATTGTCGGACCGGCCGCGGGAGTTCAGGAGC
GCCAAACTGGCAAAGTACTACGAGGAGGCGCAGTCGCCGCTCAAGGAGCCGCCCCGGATGACGGCGTGGCAGAGG
ATCATGCCGTCGGCCGCCGTGGCGCTGCTGACGGTCGGTCTCCTGGTGGGAGTGTGCGCCGTGTACGAGGAGCCG
ACGGCGCAGTACCGGCTGTTCAGGGAGATTTCGGCGTCGCAGGCTACCTTGGCGACGCTGGTGGCCATCAACGTG
GCCGTCTTCGCCTGCTGGCGGGTCCCGCCGCTGTGGAAGACGTTTAACAAGTACATGATTCTGGTGGTGGGCAAG
CCGCGGGCGGCGGCGGTCCTGACGAGCGTCTTTTCGCACATATCGCTGGTTCACCTGGTGCTGAACATGGTACCG
CTGTGGTTCGTCGGCACGCGGCTGCACGACGACCTGGACAGGGCCGAGTTCCTGACGCTGTACGTCGGCTGCGGC
GTCATGGGCTTCCTCAGCAGCCTGGTCGCCTACACCATGCGCGGGATGCTGGTGGTGTCCACGCTGGGATCGTCG
GGCGCCACGCTGGGCGTGCTGTCGGCTTACCTGTGGGAGGCCAGGCGAGAGGGCTTCCGCATGTTTGGCCTGCCG
AGGGAAGGGGTTCACGGCGTGGTGTTACTGGGCCTGCTGACGGCCGTGCAGCTGGGGGGACTCTGCAGGGCCAGC
AAGTACAAGGTGGACTTTGTATCGCACCTGATGGGCATGGCTACGGGGGTGGCCGGCATGGAGCTGATCATCCGC
AAGAGGGAGGCTGCAGCCGCGGCGGCGAGAAGAAACCTTGGGAAGCCAAGGCCGGTTGAGGTCGAGCGAGGGACG
GCCTTGAAACGTTGA
Transcript >Ophcf2|00271
ATGGCCAGCCTGTTGTGTCCTCGGGTCTCGCGCGTCCTTCTGAGTCCCGTCTCAAGCAGCAGCTTCTCATGGACG
ATGCTGCTGCAGGCGCCGTGCCTCCCCTCTCGGCGTCGAGACGAGGCTCTGCGGCCTAGGACGCGGCAGCAGCCG
CAGCAGCAGCAGATCAGCCGACGGAGCCTATGGTCGCTGACGAAAAAGGGCGAGCGCGTCGTCATCAGATACGAG
GAGCTGCCGCGTGACTACCGTGACAGCAGGGGCCTCGCCTTCTGGCGCAGAGACCTGTATCTGGGCGAGGTCAGG
AGGATCTTTGGGCCGGACATGGACACGGACGAGGGAAATCGGCTTCTACGCATTCTTCACGGTCGAAGGGTAGCA
GGAACTCTCGAAGACCCGGCTTTGTCTGTTCACACGGCCCGCTTCACGGCACAGCAACTGGCCGACGGGCTGGCG
TACCTGAGAAAGACGGTGTCGGTGGACGAGGTGTTGAGTGCGGGGCTGAGGGCCGAGGATGAGCTGAAGCTCATG
GAACTGGAGGCGGAGAAGAAGAAGCCCGTCGAGAAGCAAGAGGCGGCCGACAAGGAAGAGGTCCGAGAAGAGGAG
ACGACGACAGATGGCGTTTACAAGCCCGATCCGGTTTACGGCCGAAGCATCCTGGACGAGATCCGAGCGCGCAAC
ATTGCCAAGCGAAAGGCGCGGGAAAAGGCGCTCGAGGAGGAGCGACAGGCAGCGCGGACGGCACTCGGCGACGGC
AGCGTGGACGTCGTCCCGGTGACGGATGGCGACTCGTCACGCGCATTGTCGGACCGGCCGCGGGAGTTCAGGAGC
GCCAAACTGGCAAAGTACTACGAGGAGGCGCAGTCGCCGCTCAAGGAGCCGCCCCGGATGACGGCGTGGCAGAGG
ATCATGCCGTCGGCCGCCGTGGCGCTGCTGACGGTCGGTCTCCTGGTGGGAGTGTGCGCCGTGTACGAGGAGCCG
ACGGCGCAGTACCGGCTGTTCAGGGAGATTTCGGCGTCGCAGGCTACCTTGGCGACGCTGGTGGCCATCAACGTG
GCCGTCTTCGCCTGCTGGCGGGTCCCGCCGCTGTGGAAGACGTTTAACAAGTACATGATTCTGGTGGTGGGCAAG
CCGCGGGCGGCGGCGGTCCTGACGAGCGTCTTTTCGCACATATCGCTGGTTCACCTGGTGCTGAACATGGTACCG
CTGTGGTTCGTCGGCACGCGGCTGCACGACGACCTGGACAGGGCCGAGTTCCTGACGCTGTACGTCGGCTGCGGC
GTCATGGGCTTCCTCAGCAGCCTGGTCGCCTACACCATGCGCGGGATGCTGGTGGTGTCCACGCTGGGATCGTCG
GGCGCCACGCTGGGCGTGCTGTCGGCTTACCTGTGGGAGGCCAGGCGAGAGGGCTTCCGCATGTTTGGCCTGCCG
AGGGAAGGGGTTCACGGCGTGGTGTTACTGGGCCTGCTGACGGCCGTGCAGCTGGGGGGACTCTGCAGGGCCAGC
AAGTACAAGGTGGACTTTGTATCGCACCTGATGGGCATGGCTACGGGGGTGGCCGGCATGGAGCTGATCATCCGC
AAGAGGGAGGCTGCAGCCGCGGCGGCGAGAAGAAACCTTGGGAAGCCAAGGCCGGTTGAGGTCGAGCGAGGGACG
GCCTTGAAACGTTGA
Gene >Ophcf2|00271
ATGGCCAGCCTGTTGTGTCCTCGGGTCTCGCGCGTCCTTCTGAGTCCCGTCTCAAGCAGCAGCTTCTCATGGACG
ATGCTGCTGCAGGCGCCGTGCCTCCCCTCTCGGCGTCGAGACGAGGCTCTGCGGCCTAGGACGCGGCAGCAGCCG
CAGCAGCAGCAGATCAGCCGACGGAGCCTATGGTCGCTGACGAAAAAGGGCGAGCGCGTCGTCATCAGATACGAG
GAGCTGCCGCGTGACTACCGTGACAGCAGGGGCCTCGCCTTCTGGCGCAGAGACCTGTATCTGGGCGAGGTCAGG
AGGATCTTTGGGCCGGACATGGACACGGACGAGGGAAATCGGCTTCTACGCATTCTTCACGGTCGAAGGGTAGCA
GGAACTCTCGAAGACCCGGCTTTGTCTGTTCACACGGCCCGCTTCACGGCACAGCAACTGGCCGACGGGCTGGCG
TACCTGAGAAAGACGGTGTCGGTGGACGAGGTGTTGAGTGCGGGGCTGAGGGCCGAGGATGAGCTGAAGCTCATG
GAACTGGAGGCGGAGAAGAAGAAGCCCGTCGAGAAGCAAGAGGCGGCCGACAAGGAAGAGGTCCGAGAAGAGGAG
ACGACGACAGATGGCGTTTACAAGCCCGATCCGGTTTACGGCCGAAGCATCCTGGACGAGATCCGAGCGCGCAAC
ATTGCCAAGCGAAAGGCGCGGGAAAAGGCGCTCGAGGAGGAGCGACAGGCAGCGCGGACGGCACTCGGCGACGGC
AGCGTGGACGTCGTCCCGGTGACGGATGGCGACTCGTCACGCGCATTGTCGGACCGGCCGCGGGAGTTCAGGAGC
GCCAAACTGGCAAAGTACTACGAGGAGGCGCAGTCGCCGCTCAAGGAGCCGCCCCGGATGACGGCGTGGCAGAGG
ATCATGCCGTCGGCCGCCGTGGCGCTGCTGACGGTCGGTCTCCTGGTGGGAGTGTGCGCCGTGTACGAGGAGCCG
ACGGCGCAGTACCGGCTGTTCAGGGAGATTTCGGCGTCGCAGGCTACCTTGGCGACGCTGGTGGCCATCAACGTG
GCCGTCTTCGCCTGCTGGCGGGTCCCGCCGCTGTGGAAGACGTTTAACAAGTACATGATTCTGGTGGTGGGCAAG
CCGCGGGCGGCGGCGGTCCTGACGAGCGTCTTTTCGCACATATCGCTGGTTCACCTGGTGCTGAACATGGTACCG
CTGTGGTTCGTCGGCACGCGGCTGCACGACGACCTGGACAGGGCCGAGTTCCTGACGCTGTACGTCGGCTGCGGC
GTCATGGGCTTCCTCAGCAGCCTGGTCGCCTACACCATGCGCGGGATGCTGGTGGTGTCCACGCTGGGATCGTCG
GGCGCCACGCTGGGCGTGCTGTCGGCTTACCTGTGGGAGGCCAGGCGAGAGGGCTTCCGCATGTTTGGCCTGCCG
AGGGAAGGGGTTCACGGCGTGGTGTTACTGGGCCTGCTGACGGCCGTGCAGCTGGGGGGACTCTGCAGGGCCAGC
AAGTACAAGGTGGACTTTGTATCGCACCTGATGGGCATGGCTACGGGGGTGGCCGGCATGGAGCTGATCATCCGC
AAGAGGGAGGCTGCAGCCGCGGCGGCGAGAAGAAACCTTGGGAAGCCAAGGCCGGTTGAGGTCGAGCGAGGGACG
GCCTTGAAACGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail