Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00264
Gene name
Locationscaffold_01:1321709..1322519
Strand-
Gene length (bp)810
Transcript length (bp)810
Coding sequence length (bp)810
Protein length (aa) 270

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01522 Polysacc_deac_1 Polysaccharide deacetylase 1.5E-17 69 194

GO

GO Term Description Terminal node
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00264
MPRLALLLRLPNRLRRRVRRNRMATMAALTALTALLLLPLYSAYCVYKPPRFLVSYLRGRYPDVLFELTTTERVM
ALSLDDAPSSHTADILEVLRENEARATFFVIGDQVPGREESLRDLVRRGHELANHAMHDEPSRSLPDDRLEEDVK
AVNKMLVAAYAAEGSSLPNNYFRPGSGLVSRRMRDLVGSRGFRIVLGSVYPHDPQIPYPTVNARHILSMAHPGAI
IICHDRRKWTAPMLRIVLPELRRRGYSIVTITDLVKKVEPLGGR*
Coding >Ophcf2|00264
ATGCCCCGACTGGCGCTCCTCCTCCGGCTACCAAACCGTCTCCGAAGACGCGTACGGCGCAATCGGATGGCGACG
ATGGCGGCGCTGACGGCGCTGACGGCGCTGCTACTCCTACCGCTCTACTCGGCCTACTGCGTCTACAAGCCGCCC
CGGTTCCTGGTGTCGTACCTTCGGGGCCGGTATCCGGACGTGCTGTTCGAGCTGACGACTACGGAGCGCGTCATG
GCTCTCTCTCTCGATGACGCGCCGTCGTCTCACACGGCTGACATCCTCGAGGTGCTACGCGAGAACGAGGCGAGG
GCTACCTTTTTCGTTATAGGCGATCAGGTCCCCGGAAGGGAGGAGTCCTTACGAGATCTCGTTCGTCGGGGTCAC
GAGCTGGCCAACCACGCTATGCATGATGAGCCCTCGCGATCCCTTCCGGATGACAGGCTGGAAGAAGACGTCAAG
GCCGTCAACAAGATGCTCGTCGCCGCCTACGCCGCCGAGGGCTCTTCCCTGCCTAACAATTACTTCCGGCCCGGA
TCCGGCCTCGTTAGCCGGAGGATGCGCGACCTCGTCGGCAGCCGGGGCTTCCGTATCGTTCTCGGCTCCGTCTAC
CCGCACGACCCGCAGATTCCTTACCCGACTGTCAATGCGCGTCATATCCTTAGTATGGCGCATCCTGGTGCCATC
ATCATCTGTCATGATCGACGAAAGTGGACGGCTCCCATGCTACGCATTGTCCTGCCCGAACTGCGGAGGAGGGGG
TACAGCATCGTCACCATCACCGACCTCGTCAAGAAGGTCGAGCCTCTGGGCGGTAGATAG
Transcript >Ophcf2|00264
ATGCCCCGACTGGCGCTCCTCCTCCGGCTACCAAACCGTCTCCGAAGACGCGTACGGCGCAATCGGATGGCGACG
ATGGCGGCGCTGACGGCGCTGACGGCGCTGCTACTCCTACCGCTCTACTCGGCCTACTGCGTCTACAAGCCGCCC
CGGTTCCTGGTGTCGTACCTTCGGGGCCGGTATCCGGACGTGCTGTTCGAGCTGACGACTACGGAGCGCGTCATG
GCTCTCTCTCTCGATGACGCGCCGTCGTCTCACACGGCTGACATCCTCGAGGTGCTACGCGAGAACGAGGCGAGG
GCTACCTTTTTCGTTATAGGCGATCAGGTCCCCGGAAGGGAGGAGTCCTTACGAGATCTCGTTCGTCGGGGTCAC
GAGCTGGCCAACCACGCTATGCATGATGAGCCCTCGCGATCCCTTCCGGATGACAGGCTGGAAGAAGACGTCAAG
GCCGTCAACAAGATGCTCGTCGCCGCCTACGCCGCCGAGGGCTCTTCCCTGCCTAACAATTACTTCCGGCCCGGA
TCCGGCCTCGTTAGCCGGAGGATGCGCGACCTCGTCGGCAGCCGGGGCTTCCGTATCGTTCTCGGCTCCGTCTAC
CCGCACGACCCGCAGATTCCTTACCCGACTGTCAATGCGCGTCATATCCTTAGTATGGCGCATCCTGGTGCCATC
ATCATCTGTCATGATCGACGAAAGTGGACGGCTCCCATGCTACGCATTGTCCTGCCCGAACTGCGGAGGAGGGGG
TACAGCATCGTCACCATCACCGACCTCGTCAAGAAGGTCGAGCCTCTGGGCGGTAGATAG
Gene >Ophcf2|00264
ATGCCCCGACTGGCGCTCCTCCTCCGGCTACCAAACCGTCTCCGAAGACGCGTACGGCGCAATCGGATGGCGACG
ATGGCGGCGCTGACGGCGCTGACGGCGCTGCTACTCCTACCGCTCTACTCGGCCTACTGCGTCTACAAGCCGCCC
CGGTTCCTGGTGTCGTACCTTCGGGGCCGGTATCCGGACGTGCTGTTCGAGCTGACGACTACGGAGCGCGTCATG
GCTCTCTCTCTCGATGACGCGCCGTCGTCTCACACGGCTGACATCCTCGAGGTGCTACGCGAGAACGAGGCGAGG
GCTACCTTTTTCGTTATAGGCGATCAGGTCCCCGGAAGGGAGGAGTCCTTACGAGATCTCGTTCGTCGGGGTCAC
GAGCTGGCCAACCACGCTATGCATGATGAGCCCTCGCGATCCCTTCCGGATGACAGGCTGGAAGAAGACGTCAAG
GCCGTCAACAAGATGCTCGTCGCCGCCTACGCCGCCGAGGGCTCTTCCCTGCCTAACAATTACTTCCGGCCCGGA
TCCGGCCTCGTTAGCCGGAGGATGCGCGACCTCGTCGGCAGCCGGGGCTTCCGTATCGTTCTCGGCTCCGTCTAC
CCGCACGACCCGCAGATTCCTTACCCGACTGTCAATGCGCGTCATATCCTTAGTATGGCGCATCCTGGTGCCATC
ATCATCTGTCATGATCGACGAAAGTGGACGGCTCCCATGCTACGCATTGTCCTGCCCGAACTGCGGAGGAGGGGG
TACAGCATCGTCACCATCACCGACCTCGTCAAGAAGGTCGAGCCTCTGGGCGGTAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail