Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00260
Gene name
Locationscaffold_01:1312105..1312588
Strand+
Gene length (bp)483
Transcript length (bp)225
Coding sequence length (bp)225
Protein length (aa) 75

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00708 Acylphosphatase Acylphosphatase 2.1E-15 12 55

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5038 0.6123 0.4405 0.1757 0.2698 0.0319 0.3487 0.0581 0.2809 0.0607

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6709
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|2150
Ophiocordyceps camponoti-floridani Ophcf2|00260 (this protein)
Ophiocordyceps kimflemingae Ophio5|6073
Ophiocordyceps subramaniannii Hirsu2|6505

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00260
MTRRVYFVAHGGVVQGVGFRFFARKRANEYGVTGWCRNTSDNKVEGEAQGEDDALSLSWGMSGRGLGGRGCEAR*
Coding >Ophcf2|00260
ATGACGAGACGGGTGTACTTTGTTGCTCACGGCGGCGTCGTTCAAGGCGTCGGCTTCCGATTCTTCGCTCGGAAA
CGGGCAAACGAGTATGGCGTGACGGGCTGGTGTCGCAACACCTCTGATAACAAGGTCGAGGGCGAGGCTCAGGGC
GAGGACGACGCGTTGAGCCTTTCCTGGGGGATGTCGGGGAGGGGCCTAGGGGGCCGAGGTTGTGAAGCTCGGTAG
Transcript >Ophcf2|00260
ATGACGAGACGGGTGTACTTTGTTGCTCACGGCGGCGTCGTTCAAGGCGTCGGCTTCCGATTCTTCGCTCGGAAA
CGGGCAAACGAGTATGGCGTGACGGGCTGGTGTCGCAACACCTCTGATAACAAGGTCGAGGGCGAGGCTCAGGGC
GAGGACGACGCGTTGAGCCTTTCCTGGGGGATGTCGGGGAGGGGCCTAGGGGGCCGAGGTTGTGAAGCTCGGTAG
Gene >Ophcf2|00260
ATGACGAGACGGGTGGGCTTCACATTCGAGTCTACTGTTTACGAGCTTCGAGCTGACTATAGCCCAAAGGTGTAC
TTTGTTGCTCACGGCGGCGTCGTTCAAGGTCAGTCTGGGGGACGTGGGAGATGCATACTCTCCAACAGCTAATAC
TAACAAGCATTCTCACCAGGCGTCGGCTTCCGGTCCGCGAGCCATACCTCACCCGGAGAAACGGGCTCTAATCCC
GCTAACCCCATGCAGATTCTTCGCTCGGAAACGGGCAAACGAGTATGGCGTGACGGGCTGGTGTCGCAACACCTC
TGATAACAAGGTCCGCCGTCCCTTTCGGCTCTTTTGTTCCTTTCATTGGCTGATTGGGCGGGTTGCTGTTGTTTG
CTGCGTGTTTAGGTCGAGGGCGAGGCTCAGGGCGAGGACGACGCGTTGAGCCTTTCCTGGGGGATGTCGGGGAGG
GGCCTAGGGGGCCGAGGTTGTGAAGCTCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail