Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00257
Gene name
Locationscaffold_01:1303713..1305013
Strand+
Gene length (bp)1300
Transcript length (bp)822
Coding sequence length (bp)822
Protein length (aa) 274

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00036 EF-hand_1 EF hand 1.6E-07 143 167
PF13499 EF-hand_7 EF-hand domain pair 1.8E-10 106 166
PF13833 EF-hand_8 EF-hand domain pair 6.0E-08 118 167
PF13833 EF-hand_8 EF-hand domain pair 2.8E-02 175 195
PF13833 EF-hand_8 EF-hand domain pair 1.3E-03 185 230
PF13202 EF-hand_5 EF hand 4.9E-02 109 130
PF13202 EF-hand_5 EF hand 3.2E-02 147 163
PF13202 EF-hand_5 EF hand 2.5E-03 176 193
PF13202 EF-hand_5 EF hand 3.0E-02 241 256

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6245 0.3684 0.137 0.3923 0.0649 0.0039 0.2043 0.5363 0.0971 0.044

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2999
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2720
Ophiocordyceps australis map64 (Brazil) OphauB2|2154
Ophiocordyceps camponoti-floridani Ophcf2|00257 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6178
Ophiocordyceps kimflemingae Ophio5|6398
Ophiocordyceps subramaniannii Hirsu2|5141

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00257
MAYNRPYNPDALPRFAEPETHPGQQHPGQQHPGQQQQQQQQQRQQSSSSSSHGQSRYESKPPPPVPSSYAMTSPP
PSSSHGRPHQTASRPPPSPATESSSGADPTLLPLFRAVDKNGTGQLSERELSKALVNGDWTAFDIQTVRMMIRMF
DSDRNGTINFDEFCGLWSFLASWRTLFDRFDVDRSGNISLTEFTDALIAFRYRLSPHFVELLFRTYDKRNEGVMS
FDLFVQSCISLKRMTDVFKKYDDDRDGYITLSFEDFLGEILKQLKIRM*
Coding >Ophcf2|00257
ATGGCGTACAACAGACCCTACAACCCGGATGCCTTACCCAGGTTTGCTGAGCCGGAGACGCATCCTGGTCAGCAG
CATCCCGGTCAGCAGCATCCCGGTCAGCAGCAGCAGCAGCAGCAGCAGCAGCGGCAACAATCCTCGTCGTCCTCT
TCTCACGGCCAGTCGCGCTACGAATCGAAGCCTCCGCCGCCGGTGCCGTCTTCGTACGCAATGACGTCGCCTCCG
CCTTCTTCCAGCCACGGCCGTCCTCATCAGACGGCTTCTCGGCCACCGCCCTCGCCGGCCACGGAGAGCTCGTCG
GGCGCGGACCCGACGCTGCTCCCGCTGTTCCGTGCCGTGGACAAGAATGGCACCGGACAGCTGTCGGAACGGGAG
CTCTCCAAGGCGCTCGTAAACGGCGACTGGACGGCGTTTGACATCCAGACGGTGCGCATGATGATACGAATGTTC
GACTCGGACCGCAACGGCACCATCAACTTTGACGAGTTCTGCGGCCTGTGGTCCTTTCTCGCTTCATGGCGAACC
CTCTTCGACCGCTTCGACGTCGACCGGTCGGGCAACATCTCGCTGACCGAGTTCACGGACGCGCTCATCGCCTTC
CGCTATCGGCTCAGCCCGCACTTTGTCGAGCTGCTCTTCCGTACCTACGACAAGCGCAACGAGGGCGTCATGAGC
TTCGACCTGTTTGTTCAGAGCTGCATCTCGCTCAAGCGCATGACGGACGTGTTTAAGAAGTATGACGACGATCGC
GATGGATACATTACCCTGAGCTTCGAGGACTTTCTGGGCGAGATTCTGAAGCAGCTCAAGATAAGAATGTAG
Transcript >Ophcf2|00257
ATGGCGTACAACAGACCCTACAACCCGGATGCCTTACCCAGGTTTGCTGAGCCGGAGACGCATCCTGGTCAGCAG
CATCCCGGTCAGCAGCATCCCGGTCAGCAGCAGCAGCAGCAGCAGCAGCAGCGGCAACAATCCTCGTCGTCCTCT
TCTCACGGCCAGTCGCGCTACGAATCGAAGCCTCCGCCGCCGGTGCCGTCTTCGTACGCAATGACGTCGCCTCCG
CCTTCTTCCAGCCACGGCCGTCCTCATCAGACGGCTTCTCGGCCACCGCCCTCGCCGGCCACGGAGAGCTCGTCG
GGCGCGGACCCGACGCTGCTCCCGCTGTTCCGTGCCGTGGACAAGAATGGCACCGGACAGCTGTCGGAACGGGAG
CTCTCCAAGGCGCTCGTAAACGGCGACTGGACGGCGTTTGACATCCAGACGGTGCGCATGATGATACGAATGTTC
GACTCGGACCGCAACGGCACCATCAACTTTGACGAGTTCTGCGGCCTGTGGTCCTTTCTCGCTTCATGGCGAACC
CTCTTCGACCGCTTCGACGTCGACCGGTCGGGCAACATCTCGCTGACCGAGTTCACGGACGCGCTCATCGCCTTC
CGCTATCGGCTCAGCCCGCACTTTGTCGAGCTGCTCTTCCGTACCTACGACAAGCGCAACGAGGGCGTCATGAGC
TTCGACCTGTTTGTTCAGAGCTGCATCTCGCTCAAGCGCATGACGGACGTGTTTAAGAAGTATGACGACGATCGC
GATGGATACATTACCCTGAGCTTCGAGGACTTTCTGGGCGAGATTCTGAAGCAGCTCAAGATAAGAATGTAG
Gene >Ophcf2|00257
ATGGCGTACAACAGACCCTACAACCCGGATGCCTTACCCAGGTGCGTCACGCGTCAGGGAAGAGTGGAGGGATAT
CGAAGGCGCTACTGACTCGGGGTTTGTCTCGCAGGTTTGCTGAGCCGGAGACGGTACGTGCCGATTGCTGCGAAG
GGGGGTCCTGGACCGCTGTTGACGAGGCTGTCGTGATAGCATCCTGGTCAGCAGCATCCCGGTCAGCAGCATCCC
GGTCAGCAGCAGCAGCAGCAGCAGCAGCAGCGGCAACAATCCTCGTCGTCCTCTTCTCACGGCCAGTCGCGCTAC
GAATCGAAGCCTCCGCCGCCGGTGCCGTCTTCGTACGCAATGACGTCGCCTCCGCCTTCTTCCAGCCACGGCCGT
CCTCATCAGACGGCTTCTCGGCCACCGCCCTCGCCGGCCACGGAGAGCTCGTCGGGCGCGGACCCGACGCTGCTC
CCGCTGTTCCGTGCCGTGGACAAGAATGGTAGGAGAAGAGTGGGAGTGGAGTGGAGAGGAGAGGCCTCAGAGGAG
AGGAGAGGATGAGAGAGAGATGGCATCAGGTCGAGTGCTGACAATCGGATCAAGGCACCGGACAGCTGTCGGAAC
GGGAGCTCTCCAAGGCGCTCGTAAACGGCGACTGGACGGCGTTTGACATCCAGACGGTGCGCATGATGATACGAA
TGTTCGACTCGGACCGCAACGGCACCATCAACTTTGACGAGTTCTGCGGCCTGTGGTCCTTTCTCGCTTCATGGC
GAACCCTCTTCGACCGCTTCGACGTCGACCGGTCGGGCAACATCTCGCTGACCGAGTTCACGGACGCGCTCATCG
CCTTCCGCTATCGGCTCAGCCCGCACTTTGTCGAGCTGCTCTTCCGTACCTACGACAAGCGCAACGAGGGCGTCA
TGAGCTTCGACCTGTTTGTTCAGAGCTGCATCTCGCTCAAGCGCATGACGGACGTGTTTAAGAAGTATGACGACG
ATCGCGATGGATACATTACCCTGAGCTTCGAGGACTTTCTGGGCGAGATTCTGAAGCAGCTCAAGTGAGGTGAGG
TGAAGTGCCGAGGGACGGGCTGGGTTTACGAGTGGGTGGATGATACCCTCGGCCTCGAGCCGAGTTGGCCTCGAG
CCGAGTTGGCCTCGAGCCGAGTTCTTTCTTAACATATCTTGGTCTCGCTTGGCTGGGCTACAGGATAAGAATGTG
AGGAATTTCCCGATTTACTTTCTCTTTGCTGTAGGATGGAAGTGATCAACGAGGTTTTTTCAACCTTTGAAAGTG
CACTTGCTGACTACCAGGTAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail