Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00252
Gene name
Locationscaffold_01:1293905..1294734
Strand-
Gene length (bp)829
Transcript length (bp)585
Coding sequence length (bp)585
Protein length (aa) 195

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05832 DUF846 Eukaryotic protein of unknown function (DUF846) 1.1E-50 19 159

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 37 59 22
2 111 133 22
3 137 156 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 126.85 69.54 184.15
Alive In ants, during behavior modification 115.01 61.93 168.08
Dead In ants, recently dead 91.26 47.60 134.93

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.669614 no
Alive Dead 0.200183 no
Dead Fungus 0.101319 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00252
MEAAGGSVAPGSLSWRLSSHPITLLTFLAFRTSSVVIYFLGLWVIKSMIMIFIITILLLAADFYYLKNIAGRRLV
GLRWWNEVDVQTGDSKWVFESSEPGARVINATDSRFFWLALYVQPLLWVVMAILAIVRLQFLWLPLVVIALILTI
MNSLAFSRCDKFSQASNMAGSAIGTSNLAGSIASNMFGRLFSRN*
Coding >Ophcf2|00252
ATGGAGGCTGCGGGTGGGAGCGTGGCGCCCGGCTCGTTGAGCTGGAGGTTGAGTTCGCATCCCATCACGCTACTC
ACCTTTCTCGCCTTCCGAACCTCCAGCGTCGTCATCTACTTCCTCGGCCTCTGGGTCATCAAAAGCATGATAATG
ATCTTCATCATAACCATCCTCCTCCTCGCCGCCGATTTCTACTACCTCAAGAACATCGCAGGCCGAAGACTGGTG
GGATTGCGGTGGTGGAACGAGGTCGACGTCCAAACCGGCGATTCGAAATGGGTCTTTGAGAGCAGCGAGCCCGGC
GCCCGCGTCATCAACGCCACCGACTCGCGATTCTTCTGGCTGGCCCTCTATGTCCAGCCTTTGCTCTGGGTCGTC
ATGGCTATCCTCGCCATCGTGAGGTTGCAGTTCTTATGGCTTCCCCTTGTTGTCATCGCCCTCATCCTCACAATC
ATGAACTCGCTAGCCTTCTCCCGCTGCGATAAATTCAGCCAGGCTTCCAACATGGCCGGCTCAGCCATCGGAACG
TCCAATCTCGCCGGTAGCATCGCCTCCAACATGTTCGGCCGCCTCTTCTCCCGCAACTGA
Transcript >Ophcf2|00252
ATGGAGGCTGCGGGTGGGAGCGTGGCGCCCGGCTCGTTGAGCTGGAGGTTGAGTTCGCATCCCATCACGCTACTC
ACCTTTCTCGCCTTCCGAACCTCCAGCGTCGTCATCTACTTCCTCGGCCTCTGGGTCATCAAAAGCATGATAATG
ATCTTCATCATAACCATCCTCCTCCTCGCCGCCGATTTCTACTACCTCAAGAACATCGCAGGCCGAAGACTGGTG
GGATTGCGGTGGTGGAACGAGGTCGACGTCCAAACCGGCGATTCGAAATGGGTCTTTGAGAGCAGCGAGCCCGGC
GCCCGCGTCATCAACGCCACCGACTCGCGATTCTTCTGGCTGGCCCTCTATGTCCAGCCTTTGCTCTGGGTCGTC
ATGGCTATCCTCGCCATCGTGAGGTTGCAGTTCTTATGGCTTCCCCTTGTTGTCATCGCCCTCATCCTCACAATC
ATGAACTCGCTAGCCTTCTCCCGCTGCGATAAATTCAGCCAGGCTTCCAACATGGCCGGCTCAGCCATCGGAACG
TCCAATCTCGCCGGTAGCATCGCCTCCAACATGTTCGGCCGCCTCTTCTCCCGCAACTGA
Gene >Ophcf2|00252
ATGGAGGCTGCGGGTGGGAGCGTGGCGCCCGGCTCGTTGAGCTGGAGGTTGAGTTCGCATCCCATCACGCTACTC
ACCTTTCTCGCCTTCCGAACCTGTCAGTTCCTGTCGTCGTCTCCCTGTCGTCGTCTCCCTCCTCCACCGTGACTA
TCTACCTAGCTACCTACCCTGCCTAGCTGACAGCATGACAGCCAGCGTCGTCATCTACTTCCTCGGCCTCTGGGT
CATCAAAAGCATGTCCGTCACACCCCTCCTCCCCTTCGCCCCCCCCCCCCCCCCCCCAAAACTCCACGGGCACGA
CAGCTAAAGCCAAACCCCCGCAGGATAATGATCTTCATCATAACCATCCTCCTCCTCGCCGCCGATTTCTACTAC
CTCAAGAACATCGCAGGCCGAAGACTGGTGGGATTGCGGTGGTGGAACGAGGTCGACGTCCAAACCGGCGATTCG
AAATGGGTCTTTGAGAGCAGCGAGCCCGGCGCCCGCGTCATCAACGCCACCGACTCGCGATTCTTCTGGCTGGCC
CTCTATGTCCAGCCTTTGCTCTGGGTCGTCATGGCTATCCTCGCCATCGTGAGGTTGCAGTTCTTATGGCTTCCC
CTTGTTGGTTCGTACCCCCCTTCCCCCCGCACTCAGCTCCAATCAGGTCATGGAAATTGACAATGATAAAGTCAT
CGCCCTCATCCTCACAATCATGAACTCGCTAGCCTTCTCCCGCTGCGATAAATTCAGCCAGGCTTCCAACATGGC
CGGCTCAGCCATCGGAACGTCCAATCTCGCCGGTAGCATCGCCTCCAACATGTTCGGCCGCCTCTTCTCCCGCAA
CTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail