Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00250
Gene name
Locationscaffold_01:1287949..1291301
Strand+
Gene length (bp)3352
Transcript length (bp)3282
Coding sequence length (bp)3282
Protein length (aa) 1094

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05277 DUF726 Protein of unknown function (DUF726) 2.3E-126 546 881

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

Domain # Start End Length
1 548 570 22
2 577 599 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 47.65 26.69 68.61
Alive In ants, during behavior modification 61.79 33.27 90.31
Dead In ants, recently dead 68.24 36.54 99.94

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.203617 no
Alive Dead 0.625621 no
Dead Fungus 0.068433 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00250
MDSAINKDKEPDGRPTVPDADDFGLPIRHYPPPQPASLTAEEGNDDAVSGTRLTSDGALSPMADSAKTPDAESDC
DETAFEDAQPVIENADDAVSKASEALPSSPPPPPVDPGPTTPGSERSRLDDSAITTSGADVATPNLSQRDTDSTP
RAEQGTPRPTASKSSDDMPRTRRSRGDSLTGGTANGLAISEFSHQQLSMQPKAEEEDVDDGWQTMPAYARFDMYD
DNDRLIAREHHEDEQAADAGYSGLGGAGNGYTRVIMDDDAQSATSLDENTKYLFKDANGTSMAGDDEGRDAIAQM
QATKDILTEGQRIAYVGVVRLEIAELVKDADAVEVTKKNKREVRAASEAVKMWGQKMMIRLYGHMDISAAEQLMI
EQLSAHDVRPRDLTPALHANSRVQNPMALEAGERRSSKPSPGGIGEEQEEVVEEEKVAEAPPPYEADTSLGEEVP
EAQTPSQLPTTDEIDIDLRWTVLCDLFLVLIADSAYDARSRVLLERVGASLDISWIDICRFEKRITDALEMQQQA
EKENWNEDEHMENRRKMALKRRYVMMGLATVGGGLVIGLSAGLLAPVIGAGLAAGFTTIGVTGTSGFLAGAGGAA
VITSGAAASGSIIGVRAANRRTGAVKTFEYRPLHNKKRVNLIVTVSGWLTGKVDDVRLPFSTVDPIMGDIYSVLW
EPEMLRSMGDTINILATEALTQGLQQILGSTILVSLMAALQLPIVLTKLSYLIDNPWAVSLDRATAAGLILADSL
MERSLGTRPITLVGYSLGARVIFSCLQELAKRGAYGLVQNVYLFGSPVVVKKEEYLQARTVVCGRFLNGFNRNDW
ILGYLFRLTNGGIRRVAGLAAIEDCPWLENMDVTDIVAGHMEYRKSMPTLLMKCGWMVEREEFSEIEDPDPENHQ
ERQRELINEIEEARKELERDGKAKKGSKFGIFGRRKQAERQEWEVYEDSAGKEGVRTEGNGPGVLFDVDAIRAEL
AKEKLAGTKEETLQVREIESTLPPMKLQVAPDAGPRSLRETRSAEAIPVQRPSEEAPGEAEGRLRVASFTVGRKD
DEASVRPGVVASQTLPNVALTSSWTDPDDEDFGVEKEISMTFA*
Coding >Ophcf2|00250
ATGGACAGCGCCATCAACAAGGACAAGGAACCGGACGGCAGACCAACCGTGCCTGACGCCGACGACTTTGGCCTT
CCTATTCGACACTACCCCCCTCCACAGCCTGCTTCCTTGACGGCCGAGGAAGGCAACGATGATGCCGTCTCCGGA
ACGCGACTGACCTCTGATGGGGCCCTCTCTCCCATGGCAGACTCGGCCAAGACGCCTGACGCCGAGAGCGATTGC
GACGAGACCGCCTTCGAAGACGCTCAGCCGGTCATCGAGAATGCCGATGACGCCGTATCAAAAGCCTCCGAGGCA
TTGCCATCATCGCCACCGCCGCCCCCGGTCGATCCGGGGCCAACAACGCCCGGTTCAGAGCGGTCGAGGCTCGAC
GACTCAGCCATCACAACTTCGGGCGCCGACGTGGCCACTCCGAACCTCAGCCAAAGAGACACGGACAGCACGCCT
CGCGCCGAGCAAGGGACGCCTCGGCCAACGGCATCCAAGTCGAGCGACGACATGCCACGCACCCGCCGCAGCCGA
GGCGATAGTCTGACGGGCGGCACCGCAAATGGTCTCGCCATCTCCGAGTTCTCTCATCAGCAGCTGTCGATGCAG
CCCAAGGCCGAGGAGGAAGATGTGGACGACGGCTGGCAGACGATGCCCGCATACGCGAGGTTCGACATGTATGAC
GACAATGACCGGCTTATCGCCCGAGAACATCACGAGGATGAACAGGCTGCCGACGCCGGCTACAGCGGGCTCGGC
GGCGCGGGAAACGGATACACGCGCGTCATCATGGACGACGATGCCCAGTCGGCCACGAGCTTGGACGAGAACACA
AAGTATCTCTTCAAAGATGCCAATGGCACCAGCATGGCCGGCGACGATGAAGGCCGCGATGCCATTGCGCAGATG
CAGGCAACCAAGGACATCTTGACCGAAGGCCAGCGCATAGCCTACGTCGGCGTCGTCCGGCTGGAGATTGCCGAA
CTGGTCAAGGACGCTGACGCGGTCGAGGTCACCAAGAAGAACAAGCGCGAGGTTCGGGCTGCTTCCGAGGCCGTC
AAGATGTGGGGTCAGAAGATGATGATCCGTCTCTATGGCCATATGGACATCAGCGCGGCCGAGCAGCTCATGATC
GAGCAACTGTCGGCGCACGACGTCAGGCCGAGAGACCTGACACCGGCTCTCCACGCCAACTCGAGGGTGCAAAAC
CCCATGGCCCTGGAGGCCGGCGAGAGACGGTCGTCTAAGCCGTCACCCGGCGGCATCGGGGAGGAGCAGGAAGAG
GTAGTGGAGGAGGAAAAGGTAGCCGAGGCGCCGCCGCCGTATGAAGCCGACACTTCGCTCGGAGAGGAGGTGCCT
GAGGCTCAGACGCCATCGCAGTTGCCAACGACGGACGAGATCGACATCGACCTCCGCTGGACTGTCCTGTGCGAT
CTGTTCCTCGTCCTCATCGCCGACTCGGCCTACGACGCGCGCTCGCGGGTACTCCTGGAACGCGTTGGCGCCAGC
CTCGACATCTCGTGGATCGACATCTGCCGGTTCGAGAAGCGCATCACGGACGCGCTCGAGATGCAGCAACAGGCG
GAAAAGGAGAACTGGAACGAGGACGAGCACATGGAGAACCGCAGGAAGATGGCGCTCAAGAGGAGATATGTCATG
ATGGGTCTGGCCACCGTTGGCGGAGGCCTCGTCATCGGTCTCTCGGCCGGCCTCCTGGCCCCGGTCATCGGCGCG
GGCCTCGCTGCCGGCTTCACCACCATCGGCGTCACAGGCACCAGCGGTTTTCTGGCCGGCGCCGGCGGTGCGGCC
GTCATCACGTCCGGAGCGGCCGCCTCTGGCAGCATCATCGGCGTCAGGGCGGCCAATCGACGGACCGGCGCCGTC
AAGACGTTTGAGTACCGGCCGCTGCACAATAAGAAGCGCGTCAACCTCATAGTCACCGTCTCGGGCTGGCTGACG
GGCAAAGTCGACGACGTCCGCCTGCCGTTCAGCACCGTGGATCCCATCATGGGGGACATTTACTCGGTCCTGTGG
GAGCCCGAGATGCTGCGAAGTATGGGCGACACCATCAATATCTTGGCCACCGAGGCCCTCACCCAAGGCTTGCAG
CAGATACTGGGCAGCACCATCCTCGTCAGTCTCATGGCGGCCCTTCAGCTGCCCATCGTCCTGACGAAGCTGTCG
TACCTTATCGACAACCCTTGGGCCGTGTCGCTGGACCGAGCGACGGCGGCGGGCCTCATCCTGGCCGACTCGCTC
ATGGAGCGTAGCCTGGGCACGCGGCCCATTACGCTGGTCGGCTACTCGCTGGGCGCGCGCGTCATCTTCTCGTGC
CTGCAGGAGCTGGCCAAGAGAGGCGCGTACGGGCTGGTACAGAACGTCTACCTTTTCGGCTCGCCGGTGGTGGTG
AAGAAGGAAGAGTACCTCCAGGCCAGGACCGTGGTATGCGGACGCTTCCTCAACGGCTTCAACCGCAACGACTGG
ATCCTGGGCTACCTCTTTCGCCTGACCAACGGCGGCATCCGACGGGTGGCCGGGCTGGCAGCCATCGAGGACTGC
CCGTGGCTGGAAAACATGGACGTGACGGACATAGTGGCCGGTCACATGGAATACCGAAAATCGATGCCGACGCTG
CTGATGAAGTGCGGCTGGATGGTGGAAAGGGAGGAGTTTTCGGAGATTGAGGATCCGGATCCGGAAAACCATCAG
GAGCGACAGCGGGAACTCATCAACGAGATCGAGGAGGCGCGGAAGGAGCTGGAGCGGGACGGCAAGGCCAAGAAG
GGCAGCAAGTTTGGCATATTTGGCCGGCGAAAGCAGGCGGAGAGGCAGGAGTGGGAGGTGTACGAGGACTCGGCC
GGCAAGGAGGGCGTCCGGACGGAGGGCAACGGCCCCGGGGTGCTCTTCGACGTCGACGCCATCCGGGCCGAGCTG
GCCAAGGAGAAGCTGGCCGGGACGAAGGAGGAGACGCTCCAGGTGAGGGAGATTGAGTCGACGCTACCGCCCATG
AAGCTCCAGGTGGCGCCGGATGCGGGGCCGAGGTCGCTGCGGGAAACGAGGAGCGCCGAGGCGATTCCGGTGCAG
CGGCCGAGCGAGGAGGCTCCGGGAGAGGCCGAGGGGAGGCTCCGGGTGGCGTCTTTTACCGTGGGCCGGAAAGAC
GACGAGGCTTCGGTACGGCCCGGGGTGGTGGCGTCACAGACGTTGCCCAACGTGGCTTTGACGAGCTCGTGGACG
GACCCGGACGATGAGGACTTTGGCGTGGAAAAGGAGATTTCGATGACATTTGCATAG
Transcript >Ophcf2|00250
ATGGACAGCGCCATCAACAAGGACAAGGAACCGGACGGCAGACCAACCGTGCCTGACGCCGACGACTTTGGCCTT
CCTATTCGACACTACCCCCCTCCACAGCCTGCTTCCTTGACGGCCGAGGAAGGCAACGATGATGCCGTCTCCGGA
ACGCGACTGACCTCTGATGGGGCCCTCTCTCCCATGGCAGACTCGGCCAAGACGCCTGACGCCGAGAGCGATTGC
GACGAGACCGCCTTCGAAGACGCTCAGCCGGTCATCGAGAATGCCGATGACGCCGTATCAAAAGCCTCCGAGGCA
TTGCCATCATCGCCACCGCCGCCCCCGGTCGATCCGGGGCCAACAACGCCCGGTTCAGAGCGGTCGAGGCTCGAC
GACTCAGCCATCACAACTTCGGGCGCCGACGTGGCCACTCCGAACCTCAGCCAAAGAGACACGGACAGCACGCCT
CGCGCCGAGCAAGGGACGCCTCGGCCAACGGCATCCAAGTCGAGCGACGACATGCCACGCACCCGCCGCAGCCGA
GGCGATAGTCTGACGGGCGGCACCGCAAATGGTCTCGCCATCTCCGAGTTCTCTCATCAGCAGCTGTCGATGCAG
CCCAAGGCCGAGGAGGAAGATGTGGACGACGGCTGGCAGACGATGCCCGCATACGCGAGGTTCGACATGTATGAC
GACAATGACCGGCTTATCGCCCGAGAACATCACGAGGATGAACAGGCTGCCGACGCCGGCTACAGCGGGCTCGGC
GGCGCGGGAAACGGATACACGCGCGTCATCATGGACGACGATGCCCAGTCGGCCACGAGCTTGGACGAGAACACA
AAGTATCTCTTCAAAGATGCCAATGGCACCAGCATGGCCGGCGACGATGAAGGCCGCGATGCCATTGCGCAGATG
CAGGCAACCAAGGACATCTTGACCGAAGGCCAGCGCATAGCCTACGTCGGCGTCGTCCGGCTGGAGATTGCCGAA
CTGGTCAAGGACGCTGACGCGGTCGAGGTCACCAAGAAGAACAAGCGCGAGGTTCGGGCTGCTTCCGAGGCCGTC
AAGATGTGGGGTCAGAAGATGATGATCCGTCTCTATGGCCATATGGACATCAGCGCGGCCGAGCAGCTCATGATC
GAGCAACTGTCGGCGCACGACGTCAGGCCGAGAGACCTGACACCGGCTCTCCACGCCAACTCGAGGGTGCAAAAC
CCCATGGCCCTGGAGGCCGGCGAGAGACGGTCGTCTAAGCCGTCACCCGGCGGCATCGGGGAGGAGCAGGAAGAG
GTAGTGGAGGAGGAAAAGGTAGCCGAGGCGCCGCCGCCGTATGAAGCCGACACTTCGCTCGGAGAGGAGGTGCCT
GAGGCTCAGACGCCATCGCAGTTGCCAACGACGGACGAGATCGACATCGACCTCCGCTGGACTGTCCTGTGCGAT
CTGTTCCTCGTCCTCATCGCCGACTCGGCCTACGACGCGCGCTCGCGGGTACTCCTGGAACGCGTTGGCGCCAGC
CTCGACATCTCGTGGATCGACATCTGCCGGTTCGAGAAGCGCATCACGGACGCGCTCGAGATGCAGCAACAGGCG
GAAAAGGAGAACTGGAACGAGGACGAGCACATGGAGAACCGCAGGAAGATGGCGCTCAAGAGGAGATATGTCATG
ATGGGTCTGGCCACCGTTGGCGGAGGCCTCGTCATCGGTCTCTCGGCCGGCCTCCTGGCCCCGGTCATCGGCGCG
GGCCTCGCTGCCGGCTTCACCACCATCGGCGTCACAGGCACCAGCGGTTTTCTGGCCGGCGCCGGCGGTGCGGCC
GTCATCACGTCCGGAGCGGCCGCCTCTGGCAGCATCATCGGCGTCAGGGCGGCCAATCGACGGACCGGCGCCGTC
AAGACGTTTGAGTACCGGCCGCTGCACAATAAGAAGCGCGTCAACCTCATAGTCACCGTCTCGGGCTGGCTGACG
GGCAAAGTCGACGACGTCCGCCTGCCGTTCAGCACCGTGGATCCCATCATGGGGGACATTTACTCGGTCCTGTGG
GAGCCCGAGATGCTGCGAAGTATGGGCGACACCATCAATATCTTGGCCACCGAGGCCCTCACCCAAGGCTTGCAG
CAGATACTGGGCAGCACCATCCTCGTCAGTCTCATGGCGGCCCTTCAGCTGCCCATCGTCCTGACGAAGCTGTCG
TACCTTATCGACAACCCTTGGGCCGTGTCGCTGGACCGAGCGACGGCGGCGGGCCTCATCCTGGCCGACTCGCTC
ATGGAGCGTAGCCTGGGCACGCGGCCCATTACGCTGGTCGGCTACTCGCTGGGCGCGCGCGTCATCTTCTCGTGC
CTGCAGGAGCTGGCCAAGAGAGGCGCGTACGGGCTGGTACAGAACGTCTACCTTTTCGGCTCGCCGGTGGTGGTG
AAGAAGGAAGAGTACCTCCAGGCCAGGACCGTGGTATGCGGACGCTTCCTCAACGGCTTCAACCGCAACGACTGG
ATCCTGGGCTACCTCTTTCGCCTGACCAACGGCGGCATCCGACGGGTGGCCGGGCTGGCAGCCATCGAGGACTGC
CCGTGGCTGGAAAACATGGACGTGACGGACATAGTGGCCGGTCACATGGAATACCGAAAATCGATGCCGACGCTG
CTGATGAAGTGCGGCTGGATGGTGGAAAGGGAGGAGTTTTCGGAGATTGAGGATCCGGATCCGGAAAACCATCAG
GAGCGACAGCGGGAACTCATCAACGAGATCGAGGAGGCGCGGAAGGAGCTGGAGCGGGACGGCAAGGCCAAGAAG
GGCAGCAAGTTTGGCATATTTGGCCGGCGAAAGCAGGCGGAGAGGCAGGAGTGGGAGGTGTACGAGGACTCGGCC
GGCAAGGAGGGCGTCCGGACGGAGGGCAACGGCCCCGGGGTGCTCTTCGACGTCGACGCCATCCGGGCCGAGCTG
GCCAAGGAGAAGCTGGCCGGGACGAAGGAGGAGACGCTCCAGGTGAGGGAGATTGAGTCGACGCTACCGCCCATG
AAGCTCCAGGTGGCGCCGGATGCGGGGCCGAGGTCGCTGCGGGAAACGAGGAGCGCCGAGGCGATTCCGGTGCAG
CGGCCGAGCGAGGAGGCTCCGGGAGAGGCCGAGGGGAGGCTCCGGGTGGCGTCTTTTACCGTGGGCCGGAAAGAC
GACGAGGCTTCGGTACGGCCCGGGGTGGTGGCGTCACAGACGTTGCCCAACGTGGCTTTGACGAGCTCGTGGACG
GACCCGGACGATGAGGACTTTGGCGTGGAAAAGGAGATTTCGATGACATTTGCATAG
Gene >Ophcf2|00250
ATGGACAGCGCCATCAACAAGGACAAGGAACCGGACGGCAGACCAACCGTGCCTGACGCCGACGACTTTGGCCTT
CCTATTCGACACTACCCCCCTCCACAGCCTGCTTCCTTGACGGCCGAGGAAGGCAACGATGATGCCGTCTCCGGA
ACGCGACTGACCTCTGATGGGGCCCTCTCTCCCATGGCAGACTCGGCCAAGACGCCTGACGCCGAGAGCGATTGC
GACGAGACCGCCTTCGAAGACGCTCAGCCGGTCATCGAGAATGCCGATGACGCCGTATCAAAAGCCTCCGAGGCA
TTGCCATCATCGCCACCGCCGCCCCCGGTCGATCCGGGGCCAACAACGCCCGGTTCAGAGCGGTCGAGGCTCGAC
GACTCAGCCATCACAACTTCGGGCGCCGACGTGGCCACTCCGAACCTCAGCCAAAGAGACACGGACAGCACGCCT
CGCGCCGAGCAAGGGACGCCTCGGCCAACGGCATCCAAGTCGAGCGACGACATGCCACGCACCCGCCGCAGCCGA
GGCGATAGTCTGACGGGCGGCACCGCAAATGGTCTCGCCATCTCCGAGTTCTCTCATCAGCAGCTGTCGATGCAG
CCCAAGGCCGAGGAGGAAGATGTGGACGACGGCTGGCAGACGATGCCCGCATACGCGAGGTTCGACATGTATGAC
GACAATGACCGGCTTATCGCCCGAGAACATCACGAGGATGAACAGGCTGCCGACGCCGGCTACAGCGGGCTCGGC
GGCGCGGGAAACGGATACACGCGCGTCATCATGGACGACGATGCCCAGTCGGCCACGAGCTTGGACGAGAACACA
AAGTATCTCTTCAAAGATGCCAATGGCACCAGCATGGCCGGCGACGATGAAGGCCGCGATGCCATTGCGCAGATG
CAGGCAACCAAGGACATCTTGACCGAAGGCCAGCGCATAGCCTACGTCGGCGTCGTCCGGCTGGAGATTGCCGAA
CTGGTCAAGGACGCTGACGCGGTCGAGGTCACCAAGAAGAACAAGCGCGAGGTTCGGGCTGCTTCCGAGGCCGTC
AAGATGTGGGGTCAGAAGATGATGATCCGTCTCTATGGCCATATGGACATCAGCGCGGCCGAGCAGCTCATGATC
GAGCAACTGTCGGCGCACGACGTCAGGCCGAGAGACCTGACACCGGCTCTCCACGCCAACTCGAGGGTGCAAAAC
CCCATGGCCCTGGAGGCCGGCGAGAGACGGTCGTCTAAGCCGTCACCCGGCGGCATCGGGGAGGAGCAGGAAGAG
GTAGTGGAGGAGGAAAAGGTAGCCGAGGCGCCGCCGCCGTATGAAGCCGACACTTCGCTCGGAGAGGAGGTGCCT
GAGGCTCAGACGCCATCGCAGTTGCCAACGACGGACGAGATCGACATCGACCTCCGCTGGACTGTCCTGTGCGAT
CTGTTCCTCGTCCTCATCGCCGACTCGGCCTACGACGCGCGCTCGCGGGTACTCCTGGAACGCGTTGGCGCCAGC
CTCGACATCTCGTGGATCGACATCTGCCGGTTCGAGAAGCGCATCACGGACGCGCTCGAGATGCAGCAACAGGCG
GAAAAGGAGAACTGGAACGAGGACGAGCACATGGAGAACCGCAGGAAGATGGCGCTCAAGAGGAGATATGTCATG
ATGGGTCTGGCCACCGTTGGCGGAGGCCTCGTCATCGGTCTCTCGGCCGGCCTCCTGGCCCCGGTCATCGGCGCG
GGCCTCGCTGCCGGCTTCACCACCATCGGCGTCACAGGCACCAGCGGTTTTCTGGCCGGCGCCGGCGGTGCGGCC
GTCATCACGTCCGGAGCGGCCGCCTCTGGCAGCATCATCGGCGTCAGGGCGGCCAATCGACGGACCGGCGCCGTC
AAGACGTTTGAGTACCGGCCGCTGCACAATAAGAAGCGCGTCAACCTCATAGTCACCGTCTCGGGCTGGCTGACG
GGCAAAGTCGACGACGTCCGCCTGCCGTTCAGCACCGTGGATCCCATCATGGGGGACATTTACTCGGTCCTGTGG
GAGCCCGAGATGCTGCGAAGTATGGGCGACACCATCAATATCTTGGCCACCGAGGTATGATTCTTGTCCGTCTGT
TTGTTTGTCGACTCTCATGGGGGAGCTCGCTAACTCTTGGACTCGACAGGCCCTCACCCAAGGCTTGCAGCAGAT
ACTGGGCAGCACCATCCTCGTCAGTCTCATGGCGGCCCTTCAGCTGCCCATCGTCCTGACGAAGCTGTCGTACCT
TATCGACAACCCTTGGGCCGTGTCGCTGGACCGAGCGACGGCGGCGGGCCTCATCCTGGCCGACTCGCTCATGGA
GCGTAGCCTGGGCACGCGGCCCATTACGCTGGTCGGCTACTCGCTGGGCGCGCGCGTCATCTTCTCGTGCCTGCA
GGAGCTGGCCAAGAGAGGCGCGTACGGGCTGGTACAGAACGTCTACCTTTTCGGCTCGCCGGTGGTGGTGAAGAA
GGAAGAGTACCTCCAGGCCAGGACCGTGGTATGCGGACGCTTCCTCAACGGCTTCAACCGCAACGACTGGATCCT
GGGCTACCTCTTTCGCCTGACCAACGGCGGCATCCGACGGGTGGCCGGGCTGGCAGCCATCGAGGACTGCCCGTG
GCTGGAAAACATGGACGTGACGGACATAGTGGCCGGTCACATGGAATACCGAAAATCGATGCCGACGCTGCTGAT
GAAGTGCGGCTGGATGGTGGAAAGGGAGGAGTTTTCGGAGATTGAGGATCCGGATCCGGAAAACCATCAGGAGCG
ACAGCGGGAACTCATCAACGAGATCGAGGAGGCGCGGAAGGAGCTGGAGCGGGACGGCAAGGCCAAGAAGGGCAG
CAAGTTTGGCATATTTGGCCGGCGAAAGCAGGCGGAGAGGCAGGAGTGGGAGGTGTACGAGGACTCGGCCGGCAA
GGAGGGCGTCCGGACGGAGGGCAACGGCCCCGGGGTGCTCTTCGACGTCGACGCCATCCGGGCCGAGCTGGCCAA
GGAGAAGCTGGCCGGGACGAAGGAGGAGACGCTCCAGGTGAGGGAGATTGAGTCGACGCTACCGCCCATGAAGCT
CCAGGTGGCGCCGGATGCGGGGCCGAGGTCGCTGCGGGAAACGAGGAGCGCCGAGGCGATTCCGGTGCAGCGGCC
GAGCGAGGAGGCTCCGGGAGAGGCCGAGGGGAGGCTCCGGGTGGCGTCTTTTACCGTGGGCCGGAAAGACGACGA
GGCTTCGGTACGGCCCGGGGTGGTGGCGTCACAGACGTTGCCCAACGTGGCTTTGACGAGCTCGTGGACGGACCC
GGACGATGAGGACTTTGGCGTGGAAAAGGAGATTTCGATGACATTTGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail