Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00243
Gene name
Locationscaffold_01:1266351..1268872
Strand+
Gene length (bp)2521
Transcript length (bp)2250
Coding sequence length (bp)2250
Protein length (aa) 750

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02516 STT3 Oligosaccharyl transferase STT3 subunit 4.4E-138 23 507

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0006486 protein glycosylation Yes
GO:0004576 oligosaccharyl transferase activity Yes
GO:0019538 protein metabolic process No
GO:0110165 cellular anatomical entity No
GO:0036211 protein modification process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0043170 macromolecule metabolic process No
GO:0003824 catalytic activity No
GO:0016758 hexosyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0043413 macromolecule glycosylation No
GO:0043412 macromolecule modification No
GO:0070085 glycosylation No
GO:0008150 biological_process No
GO:0016757 glycosyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 92 114 22
3 121 140 19
4 144 166 22
5 178 200 22
6 215 237 22
7 244 266 22
8 276 298 22
9 305 327 22
10 364 386 22
11 393 415 22
12 472 494 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00243
MAPVTDQAQLRAAGSKSQSTQALLKVVILCLIAITAVASRLFSVIRFESIIHEFDPWFNFRATKYLVNNGFYKFW
DWFDDRTWHPLGRVTGGTLYPGLMVTSGIIYHALRAIAIPVDIRNVCVLLAPAFSGLTAYAAYLLTNELTTLPSA
GLLAAIFMGIAPGYISRSVAGSYDNEAIAIFLLVFTFYLWIKALKVGSMLWSVFCALSYGYMVASWGGYAFITCL
LPLHTFVLICMGRYSPRLYVSYCTWYALGTLASMQIPFVGFLPVKTSEHMPALGIFGFIQLIAFIDYVKAAIPTR
QFQTFLVTILVATFGVGMLALVALTSLGYVAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPPAWPAFFFDLNMLI
WLFPAGIYLCFQELRDEHVFVIVYGLFGSYFAGVMVRLMLTLTPIVCVTAAIAMSQLIDVFIRPNSKETDETQST
GEATTKKNVKSGGLRSSEKPLLGIFGLIPRVAVLSIVLVYLLMFVSHCTWVTSNAYSSPSVVLASRMPDGSQHII
DDYREAYQWLRQNTKENAKIMSWWDYGYQIGGMADRPTLVDNNTWNNTHIAIVGKAMASREEVSYEIMRQHEVDY
VLVVFGGLLGYSGDDINKFLWMVRIAEGIWPDEVRERDFFTARGEYRVDGEATEAMKNSLMYKMCYYNYHTLFPP
GQAVDRVRGVRMPDKGPTLDVVEEAFTSENWIIRIYKVKDLDILGRDHAAAAAFDRGEKRKKPKRKGPRMLRDP*
Coding >Ophcf2|00243
ATGGCTCCCGTGACAGATCAAGCCCAGCTTCGCGCTGCGGGATCAAAGTCTCAAAGCACCCAGGCTCTTCTCAAA
GTTGTCATTCTGTGCCTCATCGCAATCACCGCCGTTGCCAGCCGTCTCTTCTCTGTCATCCGATTCGAGAGCATC
ATCCACGAGTTTGATCCGTGGTTCAACTTCAGAGCGACAAAGTATCTCGTTAACAACGGATTCTACAAGTTCTGG
GACTGGTTTGATGATCGAACCTGGCATCCTCTCGGCCGCGTTACGGGCGGTACGCTGTACCCTGGTCTGATGGTG
ACGAGCGGCATCATCTATCACGCCCTCCGCGCCATAGCCATTCCCGTCGATATCCGCAACGTCTGCGTTCTCCTC
GCGCCAGCCTTTTCTGGCCTGACGGCGTATGCGGCCTATCTGCTGACCAACGAGCTGACCACTCTGCCGTCTGCT
GGCCTCTTGGCGGCCATCTTCATGGGTATCGCCCCTGGCTACATCTCCAGGTCGGTTGCGGGCAGTTACGACAAC
GAGGCCATTGCCATCTTCCTCCTCGTCTTTACCTTTTATCTGTGGATCAAGGCCCTCAAAGTGGGATCCATGCTC
TGGAGCGTCTTCTGCGCCCTCTCTTACGGCTACATGGTGGCATCTTGGGGCGGCTACGCGTTCATCACCTGCCTC
TTGCCTCTCCATACCTTTGTCCTCATCTGCATGGGAAGATATAGCCCTCGACTCTACGTCAGCTACTGCACGTGG
TACGCCCTCGGCACCCTGGCCAGCATGCAGATCCCTTTCGTCGGCTTCCTTCCCGTCAAGACGAGCGAGCACATG
CCGGCTCTGGGCATCTTTGGCTTCATTCAACTCATCGCCTTCATTGATTATGTCAAAGCTGCTATTCCCACCCGC
CAATTCCAGACTTTTCTCGTCACCATCCTGGTTGCTACCTTTGGTGTCGGCATGTTGGCGCTCGTGGCTCTCACT
TCTCTCGGCTACGTCGCCCCCTGGAGCGGCCGTTTCTATTCTCTCTGGGATACGGGCTACGCCAAGATACACATC
CCCATCATCGCCTCCGTATCGGAGCATCAGCCGCCGGCCTGGCCTGCTTTTTTCTTTGACCTCAACATGCTCATC
TGGTTGTTTCCGGCGGGCATCTACCTGTGCTTCCAGGAGCTTCGGGACGAGCATGTTTTCGTCATCGTCTACGGC
CTCTTTGGCAGCTACTTTGCCGGCGTCATGGTTCGACTGATGCTCACGCTCACGCCCATTGTCTGCGTCACGGCT
GCCATTGCCATGTCTCAGCTCATTGACGTCTTTATTCGTCCCAATTCCAAGGAGACGGATGAGACGCAGAGCACG
GGCGAGGCAACGACCAAGAAGAACGTCAAGAGTGGCGGCCTCCGCAGCAGCGAGAAGCCGCTTCTCGGAATCTTC
GGCTTGATCCCGCGGGTGGCTGTCCTCTCGATAGTGCTGGTCTATCTGCTCATGTTCGTGAGCCACTGCACTTGG
GTGACGTCCAACGCCTACTCGTCGCCGTCGGTGGTGCTGGCCAGCCGGATGCCCGATGGCTCGCAACACATCATC
GACGACTACCGGGAGGCGTACCAGTGGCTTCGACAGAACACCAAGGAGAATGCCAAGATCATGTCGTGGTGGGAC
TACGGCTACCAGATCGGCGGCATGGCGGACCGACCGACGCTGGTGGACAACAATACCTGGAACAACACGCACATC
GCGATTGTGGGCAAGGCCATGGCGTCGCGAGAGGAGGTCAGCTATGAAATCATGCGACAGCACGAGGTCGACTAC
GTTCTCGTCGTCTTTGGCGGCCTTTTGGGCTACTCGGGAGACGACATCAACAAGTTCCTCTGGATGGTGCGCATC
GCCGAGGGCATCTGGCCGGACGAGGTCAGGGAGCGCGACTTTTTCACAGCCCGCGGCGAGTACCGCGTCGACGGC
GAGGCGACGGAGGCGATGAAGAACAGCCTGATGTACAAGATGTGCTACTACAACTACCACACGCTGTTCCCGCCC
GGTCAGGCGGTCGACCGTGTCCGCGGCGTTCGGATGCCGGACAAAGGGCCTACTCTGGACGTGGTGGAAGAGGCC
TTTACCAGCGAGAACTGGATCATCCGCATCTACAAGGTCAAGGATCTGGACATACTCGGTCGCGACCATGCCGCT
GCGGCGGCCTTTGACCGCGGGGAGAAGCGAAAGAAGCCCAAGAGGAAAGGGCCGCGCATGCTCCGAGACCCGTAG
Transcript >Ophcf2|00243
ATGGCTCCCGTGACAGATCAAGCCCAGCTTCGCGCTGCGGGATCAAAGTCTCAAAGCACCCAGGCTCTTCTCAAA
GTTGTCATTCTGTGCCTCATCGCAATCACCGCCGTTGCCAGCCGTCTCTTCTCTGTCATCCGATTCGAGAGCATC
ATCCACGAGTTTGATCCGTGGTTCAACTTCAGAGCGACAAAGTATCTCGTTAACAACGGATTCTACAAGTTCTGG
GACTGGTTTGATGATCGAACCTGGCATCCTCTCGGCCGCGTTACGGGCGGTACGCTGTACCCTGGTCTGATGGTG
ACGAGCGGCATCATCTATCACGCCCTCCGCGCCATAGCCATTCCCGTCGATATCCGCAACGTCTGCGTTCTCCTC
GCGCCAGCCTTTTCTGGCCTGACGGCGTATGCGGCCTATCTGCTGACCAACGAGCTGACCACTCTGCCGTCTGCT
GGCCTCTTGGCGGCCATCTTCATGGGTATCGCCCCTGGCTACATCTCCAGGTCGGTTGCGGGCAGTTACGACAAC
GAGGCCATTGCCATCTTCCTCCTCGTCTTTACCTTTTATCTGTGGATCAAGGCCCTCAAAGTGGGATCCATGCTC
TGGAGCGTCTTCTGCGCCCTCTCTTACGGCTACATGGTGGCATCTTGGGGCGGCTACGCGTTCATCACCTGCCTC
TTGCCTCTCCATACCTTTGTCCTCATCTGCATGGGAAGATATAGCCCTCGACTCTACGTCAGCTACTGCACGTGG
TACGCCCTCGGCACCCTGGCCAGCATGCAGATCCCTTTCGTCGGCTTCCTTCCCGTCAAGACGAGCGAGCACATG
CCGGCTCTGGGCATCTTTGGCTTCATTCAACTCATCGCCTTCATTGATTATGTCAAAGCTGCTATTCCCACCCGC
CAATTCCAGACTTTTCTCGTCACCATCCTGGTTGCTACCTTTGGTGTCGGCATGTTGGCGCTCGTGGCTCTCACT
TCTCTCGGCTACGTCGCCCCCTGGAGCGGCCGTTTCTATTCTCTCTGGGATACGGGCTACGCCAAGATACACATC
CCCATCATCGCCTCCGTATCGGAGCATCAGCCGCCGGCCTGGCCTGCTTTTTTCTTTGACCTCAACATGCTCATC
TGGTTGTTTCCGGCGGGCATCTACCTGTGCTTCCAGGAGCTTCGGGACGAGCATGTTTTCGTCATCGTCTACGGC
CTCTTTGGCAGCTACTTTGCCGGCGTCATGGTTCGACTGATGCTCACGCTCACGCCCATTGTCTGCGTCACGGCT
GCCATTGCCATGTCTCAGCTCATTGACGTCTTTATTCGTCCCAATTCCAAGGAGACGGATGAGACGCAGAGCACG
GGCGAGGCAACGACCAAGAAGAACGTCAAGAGTGGCGGCCTCCGCAGCAGCGAGAAGCCGCTTCTCGGAATCTTC
GGCTTGATCCCGCGGGTGGCTGTCCTCTCGATAGTGCTGGTCTATCTGCTCATGTTCGTGAGCCACTGCACTTGG
GTGACGTCCAACGCCTACTCGTCGCCGTCGGTGGTGCTGGCCAGCCGGATGCCCGATGGCTCGCAACACATCATC
GACGACTACCGGGAGGCGTACCAGTGGCTTCGACAGAACACCAAGGAGAATGCCAAGATCATGTCGTGGTGGGAC
TACGGCTACCAGATCGGCGGCATGGCGGACCGACCGACGCTGGTGGACAACAATACCTGGAACAACACGCACATC
GCGATTGTGGGCAAGGCCATGGCGTCGCGAGAGGAGGTCAGCTATGAAATCATGCGACAGCACGAGGTCGACTAC
GTTCTCGTCGTCTTTGGCGGCCTTTTGGGCTACTCGGGAGACGACATCAACAAGTTCCTCTGGATGGTGCGCATC
GCCGAGGGCATCTGGCCGGACGAGGTCAGGGAGCGCGACTTTTTCACAGCCCGCGGCGAGTACCGCGTCGACGGC
GAGGCGACGGAGGCGATGAAGAACAGCCTGATGTACAAGATGTGCTACTACAACTACCACACGCTGTTCCCGCCC
GGTCAGGCGGTCGACCGTGTCCGCGGCGTTCGGATGCCGGACAAAGGGCCTACTCTGGACGTGGTGGAAGAGGCC
TTTACCAGCGAGAACTGGATCATCCGCATCTACAAGGTCAAGGATCTGGACATACTCGGTCGCGACCATGCCGCT
GCGGCGGCCTTTGACCGCGGGGAGAAGCGAAAGAAGCCCAAGAGGAAAGGGCCGCGCATGCTCCGAGACCCGTAG
Gene >Ophcf2|00243
ATGGCTCCCGTGACAGATCAAGCCCAGCTTCGCGCTGCGGGATCAAAGTCTCAAAGCACCCAGGCTCTTCTCAAA
GTTGTCATTCTGTGCCTCATCGCAATCACCGCCGTTGCCAGCCGTCTCTTCTCTGTCATCCGTAAGTGACGCGTT
TGAATCGTGTTTTTTGGTGATGGTTTTTTTTTCTTCATTTCACCGTTTTGCTAACTTGATTCTCGATAGGATTCG
AGAGCATCATCCACGAGTGTACGTGTCTTCCCCCAAGCTTTCCTTGTCTCGTCTCCTGACGTGAGCACCGTTCCT
TACTGACTGCAAACAGTTGATCCGTGGTTCAACTTCAGAGCGACAAAGTATCTCGTTAACAACGGATTCTACAAG
TTCTGGGACTGGTTTGATGATCGAACCTGGCATCCTCTCGGCCGCGTTACGGGCGGTACGCTGTACCCTGGTCTG
ATGGTGACGAGCGGCATCATCTATCACGCCCTCCGCGCCATAGCCATTCCCGTCGATATCCGCAACGTCTGCGTT
CTCCTCGCGCCAGCCTTTTCTGGCCTGACGGCGTATGCGGCCTATCTGCTGACCAACGAGCTGACCACTCTGCCG
TCTGCTGGCCTCTTGGCGGCCATCTTCATGGGTATCGCCCCTGGCTACATCTCCAGGTCGGTTGCGGGCAGTTAC
GACAACGAGGCCATTGCCATCTTCCTCCTCGTCTTTACCTTTTATCTGTGGATCAAGGCCCTCAAAGTGGGATCC
ATGCTCTGGAGCGTCTTCTGCGCCCTCTCTTACGGCTACATGGTGGCATCTTGGGGCGGCTACGCGTTCATCACC
TGCCTCTTGCCTCTCCATACCTTTGTCCTCATCTGCATGGGAAGATATAGCCCTCGACTCTACGTCAGCTACTGC
ACGTGGTACGCCCTCGGCACCCTGGCCAGCATGCAGATCCCTTTCGTCGGCTTCCTTCCCGTCAAGACGAGCGAG
CACATGCCGGCTCTGGGTATGATACCTCGCGTGGAGGAGTGGTTCGTCCACGCTAACCTTGCCGCACTAGGCATC
TTTGGCTTCATTCAACTCATCGCCTTCATTGATTATGTCAAAGCTGCTATTCCCACCCGCCAATTCCAGACTTTT
CTCGTCACCATCCTGGTTGCTACCTTTGGTGTCGGCATGTTGGCGCTCGTGGCTCTCACTTCTCTCGGCTACGTC
GCCCCCTGGAGCGGCCGTTTCTATTCTCTCTGGGATACGGGCTACGCCAAGATACACATCCCCATCATCGCCTCC
GTATCGGAGCATCAGCCGCCGGCCTGGCCTGCTTTTTTCTTTGACCTCAACATGCTCATCTGGTTGTTTCCGGCG
GGCATCTACCTGTGCTTCCAGGAGCTTCGGGACGAGCATGTTTTCGTCATCGTCTACGGCCTCTTTGGCAGCTAC
TTTGCCGGCGTCATGGTTCGACTGATGCTCACGCTCACGCCCATTGTCTGCGTCACGGCTGCCATTGCCATGTCT
CAGCTCATTGACGTCTTTATTCGTCCCAATTCCAAGGAGACGGATGAGACGCAGAGCACGGGCGAGGCAACGACC
AAGAAGAACGTCAAGAGTGGCGGCCTCCGCAGCAGCGAGAAGCCGCTTCTCGGAATCTTCGGCTTGATCCCGCGG
GTGGCTGTCCTCTCGATAGTGCTGGTCTATCTGCTCATGTTCGTGAGCCACTGCACTTGGGTGACGTCCAACGCC
TACTCGTCGCCGTCGGTGGTGCTGGCCAGCCGGATGCCCGATGGCTCGCAACACATCATCGACGACTACCGGGAG
GCGTACCAGTGGCTTCGACAGAACACCAAGGAGAATGCCAAGATCATGTCGTGGTGGGACTACGGCTACCAGATC
GGCGGCATGGCGGACCGACCGACGCTGGTGGACAACAATACCTGGAACAACACGCACATCGCGATTGTGGGCAAG
GCCATGGCGTCGCGAGAGGAGGTCAGCTATGAAATCATGCGACAGCACGAGGTCGACTACGTTCTCGTCGTCTTT
GGCGGCCTTTTGGGCTACTCGGGAGACGACATCAACAAGTTCCTCTGGATGGTGCGCATCGCCGAGGGCATCTGG
CCGGACGAGGTCAGGGAGCGCGACTTTTTCACAGCCCGCGGCGAGTACCGCGTCGACGGCGAGGCGACGGAGGCG
ATGAAGAACAGCCTGATGTGAGTTGAGCCTTGTAACTGTACGAGATGACCGCTGGTAGGCAGCTGACGTTCTGGC
CAGGTACAAGATGTGCTACTACAACTACCACACGCTGTTCCCGCCCGGTCAGGCGGTCGACCGTGTCCGCGGCGT
TCGGATGCCGGACAAAGGGCCTACTCTGGACGTGGTGGAAGAGGCCTTTACCAGCGAGAACTGGATCATCCGCAT
CTACAAGGTCAAGGATCTGGACATACTCGGTCGCGACCATGCCGCTGCGGCGGCCTTTGACCGCGGGGAGAAGCG
AAAGAAGCCCAAGAGGAAAGGGCCGCGCATGCTCCGAGACCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail