Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00233
Gene name
Locationscaffold_01:1245675..1247007
Strand+
Gene length (bp)1332
Transcript length (bp)1197
Coding sequence length (bp)1197
Protein length (aa) 399

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain 1.1E-64 254 392
PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain 3.8E-46 132 252
PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain 3.1E-42 20 117

GO

GO Term Description Terminal node
GO:0006556 S-adenosylmethionine biosynthetic process Yes
GO:0004478 methionine adenosyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0046500 S-adenosylmethionine metabolic process No
GO:0008150 biological_process No
GO:0044272 sulfur compound biosynthetic process No
GO:0008152 metabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.551 0.4451 0.0402 0.0123 0.1935 0.0432 0.0264 0.0224 0.0212 0.6053

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1666
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6045
Ophiocordyceps australis map64 (Brazil) OphauB2|2987
Ophiocordyceps camponoti-floridani Ophcf2|00233 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2916
Ophiocordyceps kimflemingae Ophio5|7016
Ophiocordyceps subramaniannii Hirsu2|1413

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00233
MSAVNGTNGHHAVKPTQGSFLFTSESVGEGHPDKIADQVSDAILDACLAEDPLSKVACETATKTGMVMVFGEITT
KAKLDYQKIVRDVVKGIGYDDSEKGFDYKTLNLLVAIEQQSPDIAQGLHYDQALEQLGAGDQGIMFGYATDETPE
LFPLTLMLAHQLNAAMAAARRDGSLPWLRPDTKTQVTVEYRHDKGAVVPVRVHTVVISAQHSPDISTEELRKEIK
EKIIKKTIPAKYLDDQTIYHIQPSGLFIIGGPQGDAGLTGRKIIVDTYGGWGAHGGGAFSGKDFSKVDRSAAYVA
RWIAKSLVAAGLCRRALVQLSYAIGVAEPLSIHVDTYGTSDKTSDELVDIILNNFDLRPGVIVRSLSLDRPMYLQ
TAKNGHFGTNQSFTWEKPKALKF*
Coding >Ophcf2|00233
ATGTCCGCTGTCAACGGCACAAATGGTCACCACGCCGTCAAGCCCACTCAGGGAAGCTTTCTCTTCACTTCCGAG
TCCGTCGGCGAGGGCCACCCCGACAAGATCGCCGACCAAGTCTCCGATGCCATTCTCGATGCCTGCCTGGCGGAA
GACCCCCTTTCCAAGGTCGCGTGCGAGACGGCTACCAAGACGGGCATGGTCATGGTCTTTGGCGAGATCACGACA
AAAGCCAAGCTCGACTACCAGAAGATTGTCCGTGACGTTGTCAAGGGCATCGGCTACGACGACTCCGAAAAGGGC
TTCGACTACAAGACGCTCAACCTCCTCGTAGCCATCGAACAGCAGTCTCCGGACATTGCTCAGGGCCTGCACTAC
GACCAGGCCCTGGAGCAGCTCGGCGCCGGTGACCAGGGCATCATGTTTGGCTACGCCACCGACGAGACACCCGAG
CTGTTCCCCCTCACCCTGATGCTGGCCCATCAGCTCAATGCCGCCATGGCGGCTGCCCGTCGCGACGGATCCCTG
CCCTGGCTGCGGCCCGACACCAAGACGCAGGTGACGGTTGAGTACCGCCACGACAAGGGAGCCGTCGTGCCCGTC
CGCGTACACACCGTCGTCATCTCCGCCCAGCACTCGCCCGACATCTCGACCGAGGAGCTGCGCAAGGAGATTAAA
GAAAAGATTATCAAAAAGACGATCCCCGCCAAGTACCTCGACGACCAGACCATTTACCACATTCAACCCTCTGGC
CTCTTCATCATTGGCGGTCCCCAGGGCGATGCCGGCTTGACGGGCCGCAAGATCATCGTCGACACCTACGGCGGC
TGGGGTGCCCACGGCGGCGGCGCCTTTTCCGGCAAGGACTTCTCCAAGGTTGACCGGTCAGCCGCCTATGTGGCC
CGGTGGATCGCCAAGTCTCTGGTGGCAGCTGGCCTCTGCCGGAGGGCCCTCGTGCAGCTGTCGTACGCCATTGGT
GTCGCCGAGCCGCTATCCATCCACGTCGACACGTACGGTACCTCGGACAAGACGTCGGACGAACTCGTCGACATC
ATCCTCAACAACTTTGACCTGCGGCCTGGCGTCATCGTCCGCTCGCTCAGCCTCGACCGGCCCATGTACCTCCAG
ACGGCAAAGAACGGCCACTTTGGAACCAACCAATCCTTCACCTGGGAGAAGCCGAAGGCCCTGAAGTTCTGA
Transcript >Ophcf2|00233
ATGTCCGCTGTCAACGGCACAAATGGTCACCACGCCGTCAAGCCCACTCAGGGAAGCTTTCTCTTCACTTCCGAG
TCCGTCGGCGAGGGCCACCCCGACAAGATCGCCGACCAAGTCTCCGATGCCATTCTCGATGCCTGCCTGGCGGAA
GACCCCCTTTCCAAGGTCGCGTGCGAGACGGCTACCAAGACGGGCATGGTCATGGTCTTTGGCGAGATCACGACA
AAAGCCAAGCTCGACTACCAGAAGATTGTCCGTGACGTTGTCAAGGGCATCGGCTACGACGACTCCGAAAAGGGC
TTCGACTACAAGACGCTCAACCTCCTCGTAGCCATCGAACAGCAGTCTCCGGACATTGCTCAGGGCCTGCACTAC
GACCAGGCCCTGGAGCAGCTCGGCGCCGGTGACCAGGGCATCATGTTTGGCTACGCCACCGACGAGACACCCGAG
CTGTTCCCCCTCACCCTGATGCTGGCCCATCAGCTCAATGCCGCCATGGCGGCTGCCCGTCGCGACGGATCCCTG
CCCTGGCTGCGGCCCGACACCAAGACGCAGGTGACGGTTGAGTACCGCCACGACAAGGGAGCCGTCGTGCCCGTC
CGCGTACACACCGTCGTCATCTCCGCCCAGCACTCGCCCGACATCTCGACCGAGGAGCTGCGCAAGGAGATTAAA
GAAAAGATTATCAAAAAGACGATCCCCGCCAAGTACCTCGACGACCAGACCATTTACCACATTCAACCCTCTGGC
CTCTTCATCATTGGCGGTCCCCAGGGCGATGCCGGCTTGACGGGCCGCAAGATCATCGTCGACACCTACGGCGGC
TGGGGTGCCCACGGCGGCGGCGCCTTTTCCGGCAAGGACTTCTCCAAGGTTGACCGGTCAGCCGCCTATGTGGCC
CGGTGGATCGCCAAGTCTCTGGTGGCAGCTGGCCTCTGCCGGAGGGCCCTCGTGCAGCTGTCGTACGCCATTGGT
GTCGCCGAGCCGCTATCCATCCACGTCGACACGTACGGTACCTCGGACAAGACGTCGGACGAACTCGTCGACATC
ATCCTCAACAACTTTGACCTGCGGCCTGGCGTCATCGTCCGCTCGCTCAGCCTCGACCGGCCCATGTACCTCCAG
ACGGCAAAGAACGGCCACTTTGGAACCAACCAATCCTTCACCTGGGAGAAGCCGAAGGCCCTGAAGTTCTGA
Gene >Ophcf2|00233
ATGTCCGCTGTCAACGGCACAAATGGTCACCACGCCGTCAAGCCCACTCAGGGAAGCTTTCTCTTCACTGTGAGA
CCCTCGGCTGCCTCGTGGGCGTACCTTCAAGATCCCACGCTCTCCACCAGAACTGACAGGCGTCCGTCCAGTCCG
AGTCCGTCGGCGAGGGCCACCCCGACAAGATCGCCGACCAAGTCTCCGATGCCATTCTCGATGCCTGCCTGGCGG
AAGACCCCCTTTCCAAGGTCGCGTGCGAGACGGCTACCAAGACGGGCATGGTCATGGTCTTTGGCGAGATCACGA
CAAAAGCCAAGCTCGACTACCAGAAGATTGTCCGTGACGTTGTCAAGGGCATCGGCTACGACGACTCCGAAAAGG
GCTTCGACTACAAGACGCTCAACCTCCTCGTAGCCATCGAACAGCAGTCTCCGGACATTGCTCAGGGCCTGCACT
ACGACCAGGCCCTGGAGCAGCTCGGCGCCGGTGACCAGGGCATCATGTTTGGCTACGCCACCGACGAGACACCCG
AGCTGTTCCCCCTCACCCTGATGCTGGCCCATCAGCTCAATGCCGCCATGGCGGCTGCCCGTCGCGACGGATCCC
TGCCCTGGCTGCGGCCCGACACCAAGACGCAGGTGACGGTTGAGTACCGCCACGACAAGGGAGCCGTCGTGCCCG
TCCGCGTACACACCGTCGTCATCTCCGCCCAGCACTCGCCCGACATCTCGACCGAGGAGCTGCGCAAGGAGATTA
AAGAAAAGATTATCAAAAAGACGATCCCCGCCAAGTACCTCGACGACCAGACCATTTACCACGTGAGTGTCCCAT
CATGTGCCAGAGAAGCGGCGAGGACGCGACTGACTCGTGACGCAGATTCAACCCTCTGGCCTCTTCATCATTGGC
GGTCCCCAGGGCGATGCCGGCTTGACGGGCCGCAAGATCATCGTCGACACCTACGGCGGCTGGGGTGCCCACGGC
GGCGGCGCCTTTTCCGGCAAGGACTTCTCCAAGGTTGACCGGTCAGCCGCCTATGTGGCCCGGTGGATCGCCAAG
TCTCTGGTGGCAGCTGGCCTCTGCCGGAGGGCCCTCGTGCAGCTGTCGTACGCCATTGGTGTCGCCGAGCCGCTA
TCCATCCACGTCGACACGTACGGTACCTCGGACAAGACGTCGGACGAACTCGTCGACATCATCCTCAACAACTTT
GACCTGCGGCCTGGCGTCATCGTCCGCTCGCTCAGCCTCGACCGGCCCATGTACCTCCAGACGGCAAAGAACGGC
CACTTTGGAACCAACCAATCCTTCACCTGGGAGAAGCCGAAGGCCCTGAAGTTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail