Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00223
Gene name
Locationscaffold_01:1218503..1222624
Strand-
Gene length (bp)4121
Transcript length (bp)2724
Coding sequence length (bp)2724
Protein length (aa) 908

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02917 Pertussis_S1 Pertussis toxin, subunit 1 3.6E-06 181 272

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0003950 NAD+ ADP-ribosyltransferase activity Yes
GO:0005575 cellular_component No
GO:0016757 glycosyltransferase activity No
GO:0003824 catalytic activity No
GO:0016763 pentosyltransferase activity No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2667 0.1839 0.8055 0.124 0.3645 0.2793 0.3398 0.2167 0.2373 0.1257

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup108
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2055
Ophiocordyceps australis 1348a (Ghana) OphauG2|4948
Ophiocordyceps australis 1348a (Ghana) OphauG2|5391
Ophiocordyceps australis map64 (Brazil) OphauB2|1787
Ophiocordyceps australis map64 (Brazil) OphauB2|3127
Ophiocordyceps australis map64 (Brazil) OphauB2|3128
Ophiocordyceps australis map64 (Brazil) OphauB2|3183
Ophiocordyceps australis map64 (Brazil) OphauB2|3335
Ophiocordyceps camponoti-floridani Ophcf2|00223 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|875
Ophiocordyceps kimflemingae Ophio5|6442
Ophiocordyceps subramaniannii Hirsu2|10638
Ophiocordyceps subramaniannii Hirsu2|2917
Ophiocordyceps subramaniannii Hirsu2|6025

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00223
MLVMKIVLAVWRLALRITSVGNAFVSARAIAYKFRDVLLNSLAKGKLTQPRLYQDNWNLLAPALILPRRSIKRNM
KTGQLLALLVDLAVATERFPRHLPPGRRSMPASLKELEKYEPYSNGSVFVDISWVDLASSSESLLDAHLVRRQEE
RPRTYPTQAPARISALEAAGKSTPPGSRPGIFYRGDPRPPEQIFETGFKARGTDMDIYRHLSSPRESGYVSLSRS
HRAAARFAFGRVGGRVEAGYLYRIVPRNLADGHWIPDVYRGSASQEFAVAGDVPPENIHSARTLRRGEATTRVEW
VKNPGFGRRMTKCSLVKTRLCVVGEERASSPEKERTSSDDKVLSSEEQAYSPEEKAPSSSEEEERDSSSEDKVLA
SPEKKERASSEGEKASEKEQRTSSPSEEKAPSHNMASSSERKDASPQQRIHDNFRPSTHESTPLESKTRLVPLAD
KVANRQFEKLARSYKIGIESSPPPGGLEDYAYRFQRHRQTLSVAKKTSMIRTLNINDPLTKATLPYYLRSVKDAF
MENHSLTKKLATMTAIVPIAGCAFRYADHAAENGLQGQSDLHIAYDVDSVVCVASDVLLFTPLFPIAIITKIISP
MVLAYASGDLGQILDLDFVVNYRELEWNQTYSMMRDHISSYKYKVILQKSYREEISASLYMISQQSALLWAGQLM
ALSNVSSKAEAQAINQTFHQEFMDVQREVCREIKRINHRFEMQVPSEVGSKIRRLKKEHYRQFATEYYAKMKREE
EENLNQASPWVKVLPRLGHQKYWEKVYWLLDQLWDSRNSEQDDQDIVWLASSAVMTSLDLYECGRCEGIYSSLHD
SLREDGFDREDADDDGPCYGLTTRTPRDPGPRYTFTEEELERNRRPQPPLTFYEFFKASPMLLATLLRGRSPLNP
SSGIVLP*
Coding >Ophcf2|00223
ATGTTGGTAATGAAAATCGTCCTGGCAGTCTGGAGGCTGGCTCTTCGGATAACGTCGGTCGGAAACGCCTTTGTT
TCTGCTCGGGCCATTGCATACAAATTCCGTGACGTCCTCCTCAACAGCCTCGCCAAAGGGAAATTGACGCAGCCG
CGGCTCTACCAAGACAATTGGAATCTTCTGGCCCCCGCGCTGATTCTACCAAGACGGAGCATTAAGAGGAACATG
AAGACGGGTCAGCTCTTGGCGTTGTTGGTGGACTTGGCTGTGGCGACGGAGCGATTCCCTCGGCATCTCCCTCCG
GGCCGGCGATCGATGCCGGCGTCCTTGAAAGAACTGGAAAAGTACGAGCCCTACTCCAACGGCAGTGTCTTTGTC
GACATCTCGTGGGTCGATCTGGCCTCATCGAGCGAGTCTCTGCTCGACGCCCACCTGGTTCGAAGACAGGAAGAG
CGGCCGAGGACGTATCCAACCCAGGCGCCGGCCCGGATCTCGGCCCTCGAAGCAGCGGGAAAGTCGACGCCTCCG
GGGAGCAGACCGGGCATCTTCTATCGCGGCGACCCGCGGCCTCCGGAGCAGATATTCGAGACGGGCTTCAAGGCC
CGGGGCACCGACATGGACATCTACCGGCACCTCAGCTCGCCGCGGGAGTCGGGCTACGTCTCTCTCTCTCGCTCG
CACCGGGCGGCAGCGCGCTTTGCCTTTGGCCGGGTGGGAGGCCGGGTCGAGGCCGGGTATCTGTACCGGATCGTG
CCGCGGAACTTGGCGGACGGGCACTGGATCCCGGATGTTTACAGGGGCTCGGCGAGTCAGGAGTTTGCGGTGGCG
GGGGACGTTCCGCCCGAGAATATACATAGCGCGAGGACGCTTCGTCGGGGGGAGGCGACGACGAGGGTCGAGTGG
GTGAAGAATCCGGGATTCGGGCGCCGGATGACCAAGTGTAGCCTCGTGAAGACGAGGCTGTGCGTTGTTGGTGAG
GAGAGGGCTTCTTCGCCAGAGAAGGAGAGGACTTCTTCGGATGACAAGGTTTTATCGTCAGAGGAGCAGGCCTAT
TCACCAGAGGAAAAGGCTCCATCGTCGTCAGAGGAGGAGGAAAGGGATTCTTCTTCAGAGGACAAGGTTCTAGCA
TCACCGGAGAAGAAGGAGAGAGCTTCTTCAGAAGGGGAGAAGGCTTCGGAAAAGGAGCAAAGGACTTCGTCTCCA
TCCGAGGAAAAGGCCCCTTCACACAACATGGCCTCGTCGTCAGAGCGAAAGGATGCTTCACCGCAGCAAAGGATA
CACGACAACTTCAGGCCATCCACGCACGAGTCCACCCCCCTCGAATCCAAAACCAGGCTCGTCCCCCTCGCCGAC
AAGGTGGCCAACCGGCAGTTCGAGAAGCTCGCCCGCAGCTACAAGATCGGAATCGAAAGCAGCCCGCCCCCCGGA
GGCCTCGAAGACTACGCCTATCGCTTCCAGCGTCATCGTCAGACTCTCTCGGTGGCCAAGAAGACGTCCATGATC
CGCACGCTCAACATCAACGATCCGCTCACCAAGGCGACGCTGCCATACTACCTCCGTTCCGTCAAGGACGCCTTC
ATGGAGAACCACAGCCTTACCAAGAAGCTGGCGACGATGACGGCCATCGTTCCCATCGCCGGCTGTGCCTTTCGC
TACGCCGATCACGCGGCCGAGAACGGGCTCCAAGGCCAGTCGGACCTACATATAGCCTACGACGTCGATTCCGTC
GTCTGCGTCGCCAGTGACGTCCTCCTCTTCACGCCGCTTTTCCCCATCGCCATCATCACCAAGATCATCTCGCCC
ATGGTGCTGGCCTACGCTTCGGGCGACCTCGGCCAGATCCTCGACCTCGACTTCGTCGTCAACTATCGCGAGCTC
GAATGGAACCAGACGTACTCGATGATGAGGGATCACATCTCGTCCTACAAGTACAAGGTGATTCTGCAAAAGTCG
TACCGCGAGGAGATCTCGGCCAGCCTCTACATGATCTCCCAGCAGAGTGCCCTGCTGTGGGCCGGCCAGCTCATG
GCCCTCAGCAACGTCAGCTCCAAGGCGGAGGCCCAGGCCATCAACCAGACCTTTCACCAAGAGTTCATGGACGTC
CAGCGCGAGGTCTGTCGCGAGATCAAGAGGATAAACCACCGGTTCGAGATGCAGGTCCCCAGCGAGGTCGGCTCC
AAGATACGTCGTCTCAAGAAGGAACACTATCGTCAGTTCGCAACCGAGTACTACGCCAAGATGAAGCGTGAGGAG
GAAGAGAACCTCAATCAAGCCTCGCCCTGGGTCAAGGTGCTTCCGCGCCTGGGCCATCAGAAGTATTGGGAAAAG
GTCTACTGGCTGCTCGACCAGCTGTGGGACTCGCGCAACTCGGAGCAGGACGATCAGGACATCGTCTGGCTGGCC
TCGTCAGCCGTCATGACGTCGCTGGATCTGTACGAGTGTGGCCGGTGCGAGGGCATCTACAGCAGTCTGCACGAT
TCGCTTAGAGAGGACGGATTCGACAGAGAAGACGCAGACGACGACGGTCCCTGTTACGGCCTCACGACCAGGACA
CCCAGGGACCCCGGGCCTCGCTATACCTTTACCGAGGAGGAGCTGGAGAGGAACAGGAGACCTCAGCCGCCCTTG
ACATTTTATGAGTTCTTCAAAGCGAGTCCCATGTTGCTGGCCACGCTGCTACGAGGACGCTCGCCATTAAATCCT
TCGTCCGGCATCGTCCTCCCTTGA
Transcript >Ophcf2|00223
ATGTTGGTAATGAAAATCGTCCTGGCAGTCTGGAGGCTGGCTCTTCGGATAACGTCGGTCGGAAACGCCTTTGTT
TCTGCTCGGGCCATTGCATACAAATTCCGTGACGTCCTCCTCAACAGCCTCGCCAAAGGGAAATTGACGCAGCCG
CGGCTCTACCAAGACAATTGGAATCTTCTGGCCCCCGCGCTGATTCTACCAAGACGGAGCATTAAGAGGAACATG
AAGACGGGTCAGCTCTTGGCGTTGTTGGTGGACTTGGCTGTGGCGACGGAGCGATTCCCTCGGCATCTCCCTCCG
GGCCGGCGATCGATGCCGGCGTCCTTGAAAGAACTGGAAAAGTACGAGCCCTACTCCAACGGCAGTGTCTTTGTC
GACATCTCGTGGGTCGATCTGGCCTCATCGAGCGAGTCTCTGCTCGACGCCCACCTGGTTCGAAGACAGGAAGAG
CGGCCGAGGACGTATCCAACCCAGGCGCCGGCCCGGATCTCGGCCCTCGAAGCAGCGGGAAAGTCGACGCCTCCG
GGGAGCAGACCGGGCATCTTCTATCGCGGCGACCCGCGGCCTCCGGAGCAGATATTCGAGACGGGCTTCAAGGCC
CGGGGCACCGACATGGACATCTACCGGCACCTCAGCTCGCCGCGGGAGTCGGGCTACGTCTCTCTCTCTCGCTCG
CACCGGGCGGCAGCGCGCTTTGCCTTTGGCCGGGTGGGAGGCCGGGTCGAGGCCGGGTATCTGTACCGGATCGTG
CCGCGGAACTTGGCGGACGGGCACTGGATCCCGGATGTTTACAGGGGCTCGGCGAGTCAGGAGTTTGCGGTGGCG
GGGGACGTTCCGCCCGAGAATATACATAGCGCGAGGACGCTTCGTCGGGGGGAGGCGACGACGAGGGTCGAGTGG
GTGAAGAATCCGGGATTCGGGCGCCGGATGACCAAGTGTAGCCTCGTGAAGACGAGGCTGTGCGTTGTTGGTGAG
GAGAGGGCTTCTTCGCCAGAGAAGGAGAGGACTTCTTCGGATGACAAGGTTTTATCGTCAGAGGAGCAGGCCTAT
TCACCAGAGGAAAAGGCTCCATCGTCGTCAGAGGAGGAGGAAAGGGATTCTTCTTCAGAGGACAAGGTTCTAGCA
TCACCGGAGAAGAAGGAGAGAGCTTCTTCAGAAGGGGAGAAGGCTTCGGAAAAGGAGCAAAGGACTTCGTCTCCA
TCCGAGGAAAAGGCCCCTTCACACAACATGGCCTCGTCGTCAGAGCGAAAGGATGCTTCACCGCAGCAAAGGATA
CACGACAACTTCAGGCCATCCACGCACGAGTCCACCCCCCTCGAATCCAAAACCAGGCTCGTCCCCCTCGCCGAC
AAGGTGGCCAACCGGCAGTTCGAGAAGCTCGCCCGCAGCTACAAGATCGGAATCGAAAGCAGCCCGCCCCCCGGA
GGCCTCGAAGACTACGCCTATCGCTTCCAGCGTCATCGTCAGACTCTCTCGGTGGCCAAGAAGACGTCCATGATC
CGCACGCTCAACATCAACGATCCGCTCACCAAGGCGACGCTGCCATACTACCTCCGTTCCGTCAAGGACGCCTTC
ATGGAGAACCACAGCCTTACCAAGAAGCTGGCGACGATGACGGCCATCGTTCCCATCGCCGGCTGTGCCTTTCGC
TACGCCGATCACGCGGCCGAGAACGGGCTCCAAGGCCAGTCGGACCTACATATAGCCTACGACGTCGATTCCGTC
GTCTGCGTCGCCAGTGACGTCCTCCTCTTCACGCCGCTTTTCCCCATCGCCATCATCACCAAGATCATCTCGCCC
ATGGTGCTGGCCTACGCTTCGGGCGACCTCGGCCAGATCCTCGACCTCGACTTCGTCGTCAACTATCGCGAGCTC
GAATGGAACCAGACGTACTCGATGATGAGGGATCACATCTCGTCCTACAAGTACAAGGTGATTCTGCAAAAGTCG
TACCGCGAGGAGATCTCGGCCAGCCTCTACATGATCTCCCAGCAGAGTGCCCTGCTGTGGGCCGGCCAGCTCATG
GCCCTCAGCAACGTCAGCTCCAAGGCGGAGGCCCAGGCCATCAACCAGACCTTTCACCAAGAGTTCATGGACGTC
CAGCGCGAGGTCTGTCGCGAGATCAAGAGGATAAACCACCGGTTCGAGATGCAGGTCCCCAGCGAGGTCGGCTCC
AAGATACGTCGTCTCAAGAAGGAACACTATCGTCAGTTCGCAACCGAGTACTACGCCAAGATGAAGCGTGAGGAG
GAAGAGAACCTCAATCAAGCCTCGCCCTGGGTCAAGGTGCTTCCGCGCCTGGGCCATCAGAAGTATTGGGAAAAG
GTCTACTGGCTGCTCGACCAGCTGTGGGACTCGCGCAACTCGGAGCAGGACGATCAGGACATCGTCTGGCTGGCC
TCGTCAGCCGTCATGACGTCGCTGGATCTGTACGAGTGTGGCCGGTGCGAGGGCATCTACAGCAGTCTGCACGAT
TCGCTTAGAGAGGACGGATTCGACAGAGAAGACGCAGACGACGACGGTCCCTGTTACGGCCTCACGACCAGGACA
CCCAGGGACCCCGGGCCTCGCTATACCTTTACCGAGGAGGAGCTGGAGAGGAACAGGAGACCTCAGCCGCCCTTG
ACATTTTATGAGTTCTTCAAAGCGAGTCCCATGTTGCTGGCCACGCTGCTACGAGGACGCTCGCCATTAAATCCT
TCGTCCGGCATCGTCCTCCCTTGA
Gene >Ophcf2|00223
ATGTTGGTAATGAAAATCGTCCTGGCAGTCTGGAGGCTGGCTCTTCGGATAACGTCGGTCGGAAACGCCTTTGTT
TCTGCTCGGGCCATTGCATACAAATTCCGTGACGTATGTGCATACAGATTGACATATTGAGTGGAGAGAGAATGG
GGACGGCTGACAGCCCGAGCCTCGCTGCAGGTCCTCCTCAACAGCCTCGCCAAAGGGAAATTGACGCAGCCGCGG
CTCTACCAAGACAATTGGAATCTTCTGGCCCCCGCGCTGATTCTACCAAGACGGAGCATTGTATGTAGAGTATCG
GCAGGCAAATTGTGCTTAAGTTTGCAGGTGGCCAAGGTTCCTCAATACGTTTGGGCTCTAGCCGCAGCATAGCAG
ACAAAGCGCAGCTGATAAGCCATGTGCTTTGTATCCTATCTGGGCAGGGTCTTTTTGCGCAGTCGAGTGCGGAGT
TGATGACGATGATGGCTTCATCCCCGATTGAGAGGGCGGCTCGAATACCTGCCTGTCGATGAGATATACCTGGCT
CGCTGCGTCTTTCTGCCACGGCTGGGGGTACCGCAATATCTCCCTGAACGGACGGTGGGGAGCTCGGGCCCTGTC
CAACCAGTCTTTTAGCGCTTGGCGACCCTCCGTGACGGCTTCTCGGGAATAGCAGTGGCAGAGTGAGAAGGTGGG
CATGGTGGTGGATGAAGCTTGAGGAAGAGATGAAGAGACAGGACAAGGCAGGCATGAGAAGTTGGCTGCGAACCA
CATGGAACTTTATACGGATTCCTCAAAAGACCGGTCAATCAGGAGTCAGTTTCGCGAGTGGAAAGGAAGACAAGA
CGAACGGACGAAAGAAGAGGGCCGATGCGAGATATTTTGGATTGGGAGCATACATGCGGATGATAAAAAGGAGCC
GGAAACAGAGTCGGGGACTTGGGTACGTACAACAAGACGATATAAACACCAATAAGATGACGACGGGCCTACAAG
AGATATAAACAGGGCGTGCCCTCACTGGACGGGTGTGGCTACGTATGTCATATTTGCCCGGGGCCCTTCCTTTCC
CCCCCCTTCTATCTTTCGGTTGAGAGCGCCAAGTGCGACATGGCCAAAGGTTAGCGAGGACTGAAGGGACCGTAT
TCGACCGTCTTACGTCGTCTTGAGTCAAGAGGCAAGCAGAGAAGGAGAATATCCTGAGCTCGGTTCCCTCACGAG
ACAACTCTGCATACATTCTCTTTTCCTATTCCCAGACAGGAGGGAAGAAGAGGAACATGAAGACGGGTCAGCTCT
TGGCGTTGTTGGTGGACTTGGCTGTGGCGACGGAGCGATTCCCTCGGCATCTCCCTCCGGGCCGGCGATCGATGC
CGGCGTCCTTGAAAGAACTGGAAAAGTACGAGCCCTACTCCAACGGCAGTGTCTTTGTCGACATCTCGTGGGTCG
ATCTGGCCTCATCGAGCGAGTCTCTGCTCGACGCCCACCTGGTTCGAAGACAGGAAGAGCGGCCGAGGACGTATC
CAACCCAGGCGCCGGCCCGGATCTCGGCCCTCGAAGCAGCGGGAAAGTCGACGCCTCCGGGGAGCAGACCGGGCA
TCTTCTATCGCGGCGACCCGCGGCCTCCGGAGCAGATATTCGAGACGGGCTTCAAGGCCCGGGGCACCGACATGG
ACATCTACCGGCACCTCAGCTCGCCGCGGGAGTCGGGCTACGTCTCTCTCTCTCGCTCGCACCGGGCGGCAGCGC
GCTTTGCCTTTGGCCGGGTGGGAGGCCGGGTCGAGGCCGGGTATCTGTACCGGATCGTGCCGCGGAACTTGGCGG
ACGGGCACTGGATCCCGGATGTTTACAGGGGCTCGGCGAGTCAGGAGTTTGCGGTGGCGGGGGACGTTCCGCCCG
AGAATATACATAGCGCGAGGACGCTTCGTCGGGGGGAGGCGACGACGAGGGTCGAGTGGGTGAAGAATCCGGGAT
TCGGGCGCCGGATGACCAAGTGTAGCCTCGTGAAGACGAGGCTGTGCGTTGTTGGTGAGGAGAGGGCTTCTTCGC
CAGAGAAGGAGAGGACTTCTTCGGATGACAAGGTTTTATCGTCAGAGGAGCAGGCCTATTCACCAGAGGAAAAGG
CTCCATCGTCGTCAGAGGAGGAGGAAAGGGATTCTTCTTCAGAGGACAAGGTTCTAGCATCACCGGAGAAGAAGG
TTCCTTCACACGACGAGGCATCATCATCATCATCATCATCTTCTTCTTCTTCTTCTTCCTCCTCCTCTTCATCTT
CAAAGGAGAGAGCTTCTTCAGAGGGGGAGAAGGCTTCAGCCAAGGAGGAAAGGACCTCCTTGTCTTTATCTGAGG
ACAAGGCTCCATCGTCATCAGATGAAAAGGCTGCTTCATACAACAAGGCCTCGTCATCATCCTCTTCTTCCTCTT
CTTCCTCCTCTTCTTCATCTTCAAAGGAGAGAGCTTCTTCAGAAGGGGAGAAGGCTTCGGAAAAGGAGCAAAGGA
CTTCGTCTCCATCCGAGGAAAAGGCCCCTTCACACAACATGGCCTCGTCGTCAGAGCGAAAGGATGCTTCACCGC
AGCAAAGGATACACGACAACTTCAGGCCATCCACGCACGAGTCCACCCCCCTCGAATCCAAAACCAGGCTCGTCC
CCCTCGCCGACAAGGTGGCCAACCGGCAGTTCGAGAAGCTCGCCCGCAGCTACAAGATCGGAATCGAAAGCAGCC
CGCCCCCCGGAGGCCTCGAAGACTACGCCTATCGCTTCCAGCGTCATCGTCAGACTCTCTCGGTGGCCAAGAAGA
CGTCCATGATCCGCACGCTCAACATCAACGATCCGCTCACCAAGGCGACGCTGCCATACTACCTCCGTTCCGTCA
AGGACGCCTTCATGGAGAACCACAGCCTTACCAAGAAGCTGGCGACGATGACGGCCATCGTTCCCATCGCCGGCT
GTGCCTTTCGCTACGCCGATCACGCGGCCGAGAACGGGCTCCAAGGCCAGTCGGACCTACATATAGCCTACGACG
TCGATTCCGTCGTCTGCGTCGCCAGTGACGTCCTCCTCTTCACGCCGCTTTTCCCCATCGCCATCATCACCAAGA
TCATCTCGCCCATGGTGCTGGCCTACGCTTCGGGCGACCTCGGCCAGATCCTCGACCTCGACTTCGTCGTCAACT
ATCGCGAGCTCGAATGGAACCAGACGTACTCGATGATGAGGGATCACATCTCGTCCTACAAGTACAAGGTGATTC
TGCAAAAGTCGTACCGCGAGGAGATCTCGGCCAGCCTCTACATGATCTCCCAGCAGAGTGCCCTGCTGTGGGCCG
GCCAGCTCATGGCCCTCAGCAACGTCAGCTCCAAGGCGGAGGCCCAGGCCATCAACCAGACCTTTCACCAAGAGT
TCATGGACGTCCAGCGCGAGGTCTGTCGCGAGATCAAGAGGATAAACCACCGGTTCGAGATGCAGGTCCCCAGCG
AGGTCGGCTCCAAGATACGTCGTCTCAAGAAGGAACACTATCGTCAGTTCGCAACCGAGTACTACGCCAAGATGA
AGCGTGAGGAGGAAGAGAACCTCAATCAAGCCTCGCCCTGGGTCAAGGTGCTTCCGCGCCTGGGCCATCAGAAGT
ATTGGGAAAAGGTCTACTGGCTGCTCGACCAGCTGTGGGACTCGCGCAACTCGGAGCAGGACGATCAGGACATCG
TCTGGCTGGCCTCGTCAGCCGTCATGACGTCGCTGGATCTGTACGAGTGTGGCCGGTGCGAGGGCATCTACAGCA
GTCTGCACGATTCGCTTAGAGAGGGTGAGTCAGAGCCTGGAGACGATTGGAGAGGAGGAGGAGGAGGAGGAGGAG
GAGGAGAAGGAGGAGGAGGAGCAGGAGGAGCAGGAGCAGGCTGACGGACAGCACAAACAGACGGATTCGACAGAG
AAGACGCAGACGACGACGGTCCCTGTTACGGCCTCACGACCAGGACACCCAGGGACCCCGGGCCTCGCTATACCT
TTACCGAGGAGGAGCTGGAGAGGAACAGGAGACCTCAGCCGCCCTTGACATTTTATGAGTTCTTCAAAGCGAGTC
CCATGTTGCTGGCCACGCTGCTACGAGGACGCTCGCCATTAAATCCTTCGTCCGGCATCGTCCTCCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail