Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00212
Gene name
Locationscaffold_01:1190941..1192980
Strand+
Gene length (bp)2039
Transcript length (bp)1866
Coding sequence length (bp)1866
Protein length (aa) 622

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08598 Sds3 Sds3-like 4.0E-13 325 435

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1746 0.9228 0.5859 0.0166 0.0521 0.0009 0.0141 0.0082 0.0101 0.0027

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3802
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2113
Ophiocordyceps australis map64 (Brazil) OphauB2|2964
Ophiocordyceps camponoti-floridani Ophcf2|00212 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6245
Ophiocordyceps kimflemingae Ophio5|4316
Ophiocordyceps subramaniannii Hirsu2|7421

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00212
MAAAGPAQASSRPGGGSLGDSNASSPLSEVDDGDPNDDEMERIQLHPTGPVEPKPSLSGHSNNALESDSALSDAA
SDVHYDPNDTEAETERLYDTPTSQRQRDALVDHFSNGPAFEPSPSKLNRATPAVGDASLSGDDASAASSQVISSD
ALVAKSGTKVDELVTLDSQERKRKRSPLADQSGSDEPLRKRTGSVAALETTAQQDIVANEDDNASANPLSGQQSV
AEDEPSSSSNRETTSEAPERETKTTKSTRSSSKRKALPPEDAPAAAAAEADSDTREALAPEDEAEQPEEAVDADV
DEEMDAAVKNIEEMQRKHAAFRDWTHIEDMFNIFRERLYKDRLQRLEEEERSLLADEPTHPEYLNMKKCIDDRLE
KRLQEIDAEHELRMRAHERRAVAQRAQIWSQFFQAVREKRDQAVERLNQQWYEVQSARRSTHSLPEYGLFFPKEP
AQRLRNAVAYNTEVSTLAGLAKHVGFPAVPELKGASATELESDLNAIEHVRRGRQRHGRDEYQAPTFSRLGPAGE
QFLKDTPWANPNHSAHKLSLAPSDCPQRRAAPTANGPPAAEAEAKAASEGQPVVRRSPALTDSPEMARNVLSHAA
HPMKRVSSIPNLTRGTKTATA*
Coding >Ophcf2|00212
ATGGCGGCCGCCGGTCCAGCGCAGGCGTCGTCCAGGCCGGGCGGAGGGAGTCTTGGGGACAGCAACGCCTCCAGT
CCCCTTAGTGAGGTTGACGACGGCGATCCAAACGACGACGAGATGGAGCGCATTCAGCTTCATCCTACTGGCCCC
GTCGAGCCCAAGCCGAGCCTCAGCGGCCACTCCAACAACGCATTGGAGTCCGACAGCGCACTCTCCGACGCCGCT
TCTGATGTCCACTACGACCCCAACGACACCGAGGCCGAGACTGAGAGACTATACGATACTCCCACGAGCCAGAGG
CAGCGGGATGCTCTCGTCGATCATTTCAGCAACGGCCCAGCCTTCGAGCCTTCGCCTAGCAAGCTGAACAGGGCC
ACCCCAGCCGTCGGGGACGCATCCTTGTCCGGCGACGACGCATCGGCCGCCTCCAGCCAGGTCATATCAAGCGAC
GCACTCGTTGCCAAGAGTGGAACAAAGGTCGACGAGCTCGTGACGCTGGACTCGCAGGAGCGCAAGCGGAAACGT
TCCCCGCTGGCCGACCAGTCTGGGTCAGACGAACCGCTTCGCAAGCGGACCGGCTCTGTGGCAGCGCTCGAGACG
ACCGCTCAGCAAGACATAGTCGCGAATGAGGACGATAACGCGTCGGCGAACCCTCTGAGCGGTCAACAGTCCGTC
GCCGAAGACGAGCCCAGCTCGTCTTCCAACCGAGAAACGACGTCCGAAGCACCGGAACGAGAGACGAAGACGACC
AAGTCCACGCGCAGTTCGTCTAAGCGCAAAGCGCTGCCTCCCGAAGATGCCCCAGCCGCCGCCGCCGCCGAGGCC
GACAGCGACACGCGCGAGGCCCTTGCACCGGAGGACGAGGCTGAGCAGCCCGAGGAGGCGGTGGATGCAGATGTT
GACGAGGAGATGGACGCTGCAGTCAAGAATATCGAGGAGATGCAGCGGAAGCATGCCGCCTTCAGAGATTGGACT
CACATCGAGGACATGTTTAATATCTTCCGCGAGAGACTTTACAAGGATCGCCTGCAGCGGCTGGAGGAGGAGGAG
CGGTCTCTCCTGGCCGACGAGCCCACGCACCCCGAGTACCTGAACATGAAGAAGTGCATCGACGACCGCCTGGAA
AAAAGGCTGCAGGAGATTGACGCGGAACACGAGCTCCGGATGAGGGCACACGAGCGGCGAGCCGTGGCGCAGCGA
GCCCAGATCTGGAGCCAGTTCTTCCAGGCCGTGCGAGAGAAGAGAGATCAGGCGGTGGAAAGGCTCAACCAGCAG
TGGTACGAGGTGCAGAGCGCCAGGCGAAGCACCCATAGCCTGCCTGAATACGGCCTGTTCTTCCCAAAGGAGCCG
GCGCAACGGTTGAGAAACGCGGTCGCCTACAACACCGAGGTCTCGACGCTCGCCGGCCTGGCAAAGCACGTCGGC
TTCCCGGCAGTTCCCGAGCTCAAGGGCGCATCGGCGACGGAGCTGGAATCGGATCTGAATGCCATCGAGCACGTC
CGGCGTGGCCGGCAAAGGCACGGTAGAGACGAGTATCAAGCACCCACCTTTAGCCGGCTCGGACCTGCGGGAGAG
CAGTTCCTCAAGGACACGCCGTGGGCCAACCCCAACCACTCGGCCCACAAGCTGTCTCTCGCTCCGTCGGACTGT
CCCCAGCGGCGGGCGGCCCCGACGGCCAACGGTCCTCCGGCGGCGGAAGCTGAGGCCAAGGCAGCATCTGAAGGT
CAGCCGGTGGTGCGCCGGTCGCCGGCCTTGACAGACTCGCCGGAGATGGCTCGAAACGTGCTGAGCCACGCGGCG
CATCCGATGAAGCGGGTGAGCAGCATCCCGAATCTCACGCGGGGGACCAAAACCGCCACCGCTTGA
Transcript >Ophcf2|00212
ATGGCGGCCGCCGGTCCAGCGCAGGCGTCGTCCAGGCCGGGCGGAGGGAGTCTTGGGGACAGCAACGCCTCCAGT
CCCCTTAGTGAGGTTGACGACGGCGATCCAAACGACGACGAGATGGAGCGCATTCAGCTTCATCCTACTGGCCCC
GTCGAGCCCAAGCCGAGCCTCAGCGGCCACTCCAACAACGCATTGGAGTCCGACAGCGCACTCTCCGACGCCGCT
TCTGATGTCCACTACGACCCCAACGACACCGAGGCCGAGACTGAGAGACTATACGATACTCCCACGAGCCAGAGG
CAGCGGGATGCTCTCGTCGATCATTTCAGCAACGGCCCAGCCTTCGAGCCTTCGCCTAGCAAGCTGAACAGGGCC
ACCCCAGCCGTCGGGGACGCATCCTTGTCCGGCGACGACGCATCGGCCGCCTCCAGCCAGGTCATATCAAGCGAC
GCACTCGTTGCCAAGAGTGGAACAAAGGTCGACGAGCTCGTGACGCTGGACTCGCAGGAGCGCAAGCGGAAACGT
TCCCCGCTGGCCGACCAGTCTGGGTCAGACGAACCGCTTCGCAAGCGGACCGGCTCTGTGGCAGCGCTCGAGACG
ACCGCTCAGCAAGACATAGTCGCGAATGAGGACGATAACGCGTCGGCGAACCCTCTGAGCGGTCAACAGTCCGTC
GCCGAAGACGAGCCCAGCTCGTCTTCCAACCGAGAAACGACGTCCGAAGCACCGGAACGAGAGACGAAGACGACC
AAGTCCACGCGCAGTTCGTCTAAGCGCAAAGCGCTGCCTCCCGAAGATGCCCCAGCCGCCGCCGCCGCCGAGGCC
GACAGCGACACGCGCGAGGCCCTTGCACCGGAGGACGAGGCTGAGCAGCCCGAGGAGGCGGTGGATGCAGATGTT
GACGAGGAGATGGACGCTGCAGTCAAGAATATCGAGGAGATGCAGCGGAAGCATGCCGCCTTCAGAGATTGGACT
CACATCGAGGACATGTTTAATATCTTCCGCGAGAGACTTTACAAGGATCGCCTGCAGCGGCTGGAGGAGGAGGAG
CGGTCTCTCCTGGCCGACGAGCCCACGCACCCCGAGTACCTGAACATGAAGAAGTGCATCGACGACCGCCTGGAA
AAAAGGCTGCAGGAGATTGACGCGGAACACGAGCTCCGGATGAGGGCACACGAGCGGCGAGCCGTGGCGCAGCGA
GCCCAGATCTGGAGCCAGTTCTTCCAGGCCGTGCGAGAGAAGAGAGATCAGGCGGTGGAAAGGCTCAACCAGCAG
TGGTACGAGGTGCAGAGCGCCAGGCGAAGCACCCATAGCCTGCCTGAATACGGCCTGTTCTTCCCAAAGGAGCCG
GCGCAACGGTTGAGAAACGCGGTCGCCTACAACACCGAGGTCTCGACGCTCGCCGGCCTGGCAAAGCACGTCGGC
TTCCCGGCAGTTCCCGAGCTCAAGGGCGCATCGGCGACGGAGCTGGAATCGGATCTGAATGCCATCGAGCACGTC
CGGCGTGGCCGGCAAAGGCACGGTAGAGACGAGTATCAAGCACCCACCTTTAGCCGGCTCGGACCTGCGGGAGAG
CAGTTCCTCAAGGACACGCCGTGGGCCAACCCCAACCACTCGGCCCACAAGCTGTCTCTCGCTCCGTCGGACTGT
CCCCAGCGGCGGGCGGCCCCGACGGCCAACGGTCCTCCGGCGGCGGAAGCTGAGGCCAAGGCAGCATCTGAAGGT
CAGCCGGTGGTGCGCCGGTCGCCGGCCTTGACAGACTCGCCGGAGATGGCTCGAAACGTGCTGAGCCACGCGGCG
CATCCGATGAAGCGGGTGAGCAGCATCCCGAATCTCACGCGGGGGACCAAAACCGCCACCGCTTGA
Gene >Ophcf2|00212
ATGGCGGCCGCCGGTCCAGCGCAGGCGTCGTCCAGGCCGGGCGGAGGGAGTCTTGGGGACAGCAACGCCTCCAGT
CCCCTTAGTGAGGTTGACGACGGCGATCCAAACGACGACGAGATGGAGCGCATTCAGCTTCATCCTACTGGCCCC
GTCGAGCCCAAGCCGAGCCTCAGCGGCCACTCCAACAACGCATTGGAGTCCGACAGCGCACTCTCCGACGCCGCT
TCTGATGTCCACTACGACCCCAACGACACCGAGGCCGAGACTGAGAGACTATACGATACTCCCACGAGCCAGAGG
CAGCGGGATGCTCTCGTCGATCATTTCAGCAACGGCCCAGCCTTCGAGCCTTCGCCTAGCAAGCTGAACAGGGCC
ACCCCAGCCGTCGGGGACGCATCCTTGTCCGGCGACGACGCATCGGCCGCCTCCAGCCAGGTCATATCAAGCGAC
GCACTCGTTGCCAAGAGTGGAACAAAGGTCGACGAGCTCGTGACGCTGGACTCGCAGGAGCGCAAGCGGAAACGT
TCCCCGCTGGCCGACCAGTCTGGGTCAGACGAACCGCTTCGCAAGCGGACCGGCTCTGTGGCAGCGCTCGAGACG
ACCGCTCAGCAAGACATAGTCGCGAATGAGGACGATAACGCGTCGGCGAACCCTCTGAGCGGTCAACAGTCCGTC
GCCGAAGACGAGCCCAGCTCGTCTTCCAACCGAGAAACGACGTCCGAAGCACCGGAACGAGAGACGAAGACGACC
AAGTCCACGCGCAGTTCGTCTAAGCGCAAAGCGCTGCCTCCCGAAGATGCCCCAGCCGCCGCCGCCGCCGAGGCC
GACAGCGACACGCGCGAGGCCCTTGCACCGGAGGACGAGGCTGAGCAGCCCGAGGAGGCGGTGGATGCAGATGTT
GACGAGGAGATGGACGCTGCAGTCAAGAATATCGAGGAGAGTGAGTAGCCGCCCCAGAGTCACGGTCGCTTAATC
AAGGCTGACCTCGGCGCAGTGCAGCGGAAGCATGCCGCCTTCAGAGATTGGACTCACATCGAGGACATGTTTAAT
ATCTTCCGCGAGAGGTTCGTTGAGCGTTGTCTTCTCCACACGCAAAGACATTGGCTGACCCGGCACGCGAAGACT
TTACAAGGATCGCCTGCAGCGGCTGGAGGAGGAGGAGCGGTCTCTCCTGGCCGACGAGCCCACGCACCCCGAGTA
CCTGAACATGAAGAAGTGCATCGACGACCGCCTGGAAAAAAGGCTGCAGGAGATTGACGCGGAACACGAGCTCCG
GATGAGGGCACACGAGCGGCGAGCCGTGGCGCAGCGAGCCCAGATCTGGAGCCAGTTCTTCCAGGCCGTGCGAGA
GAAGAGAGATCAGGCGGTGGAAAGGCTCAACCAGCAGTGGTACGAGGTGCAGAGCGCCAGGCGAAGCACCCATAG
CCTGCCTGAATACGGCCTGTTCTTCCCAAAGGAGCCGGCGCAACGGTTGAGAAACGCGGTCGCCTACAACACCGA
GGTCTCGACGCTCGCCGGCCTGGCAAAGCACGTCGGCTTCCCGGCAGTTCCCGAGCTCAAGGGCGCATCGGCGAC
GGAGCTGGAATCGGATCTGAATGCCATCGAGGTACTCCTGGGAACCCGCATTTCCGTGCGCGTGGCCTTGACTCT
GACGTCCCTCTCTCCAGCACGTCCGGCGTGGCCGGCAAAGGCACGGTAGAGACGAGTATCAAGCACCCACCTTTA
GCCGGCTCGGACCTGCGGGAGAGCAGTTCCTCAAGGACACGCCGTGGGCCAACCCCAACCACTCGGCCCACAAGC
TGTCTCTCGCTCCGTCGGACTGTCCCCAGCGGCGGGCGGCCCCGACGGCCAACGGTCCTCCGGCGGCGGAAGCTG
AGGCCAAGGCAGCATCTGAAGGTCAGCCGGTGGTGCGCCGGTCGCCGGCCTTGACAGACTCGCCGGAGATGGCTC
GAAACGTGCTGAGCCACGCGGCGCATCCGATGAAGCGGGTGAGCAGCATCCCGAATCTCACGCGGGGGACCAAAA
CCGCCACCGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail