Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00204
Gene name
Locationscaffold_01:1174507..1175026
Strand-
Gene length (bp)519
Transcript length (bp)519
Coding sequence length (bp)519
Protein length (aa) 173

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00929 RNase_T Exonuclease 3.0E-17 1 160

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6889 0.6152 0.0372 0.1004 0.2006 0.0492 0.0541 0.1465 0.018 0.0346

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3796
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3056
Ophiocordyceps australis map64 (Brazil) OphauB2|2957
Ophiocordyceps camponoti-floridani Ophcf2|00204 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6253
Ophiocordyceps kimflemingae Ophio5|6557
Ophiocordyceps subramaniannii Hirsu2|7407

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00204
MTGLDPDTDDILEIYCLVTTANLEPLEPNGFHAIIHHPKQRLDRMNEWCRTTHGASGLSAAVTASTTTAASAAAD
LLAYVTRLVPEPRSALLAGNSVHADRAFLRREPFAPVIRHLHYRLLDVSAIKEAVRRWGPPGVLEGAPRKRVRHL
ARDDVLESIAEARFYRDAVFGR*
Coding >Ophcf2|00204
ATGACGGGCCTCGACCCCGACACAGACGACATCCTCGAAATCTACTGCCTCGTCACAACAGCCAACCTCGAACCC
CTCGAACCCAATGGCTTCCACGCCATCATCCACCACCCGAAACAGCGTCTCGACCGCATGAATGAGTGGTGCCGG
ACGACACACGGCGCCTCAGGCCTCTCAGCCGCCGTCACAGCCTCAACGACAACAGCCGCCTCAGCAGCGGCAGAC
CTCCTCGCCTACGTGACGCGCCTGGTGCCGGAGCCTCGAAGCGCACTGCTGGCGGGGAACAGCGTGCACGCGGAC
CGGGCATTCCTCCGACGTGAGCCGTTCGCGCCCGTGATCCGGCACCTGCATTACCGGCTGCTCGACGTCAGTGCC
ATCAAGGAGGCTGTTCGGCGGTGGGGGCCCCCGGGAGTGCTGGAGGGGGCGCCGAGGAAGAGGGTGAGGCATTTG
GCTAGGGATGATGTGCTGGAGAGCATTGCCGAGGCTCGCTTCTATCGCGATGCTGTGTTTGGGCGCTGA
Transcript >Ophcf2|00204
ATGACGGGCCTCGACCCCGACACAGACGACATCCTCGAAATCTACTGCCTCGTCACAACAGCCAACCTCGAACCC
CTCGAACCCAATGGCTTCCACGCCATCATCCACCACCCGAAACAGCGTCTCGACCGCATGAATGAGTGGTGCCGG
ACGACACACGGCGCCTCAGGCCTCTCAGCCGCCGTCACAGCCTCAACGACAACAGCCGCCTCAGCAGCGGCAGAC
CTCCTCGCCTACGTGACGCGCCTGGTGCCGGAGCCTCGAAGCGCACTGCTGGCGGGGAACAGCGTGCACGCGGAC
CGGGCATTCCTCCGACGTGAGCCGTTCGCGCCCGTGATCCGGCACCTGCATTACCGGCTGCTCGACGTCAGTGCC
ATCAAGGAGGCTGTTCGGCGGTGGGGGCCCCCGGGAGTGCTGGAGGGGGCGCCGAGGAAGAGGGTGAGGCATTTG
GCTAGGGATGATGTGCTGGAGAGCATTGCCGAGGCTCGCTTCTATCGCGATGCTGTGTTTGGGCGCTGA
Gene >Ophcf2|00204
ATGACGGGCCTCGACCCCGACACAGACGACATCCTCGAAATCTACTGCCTCGTCACAACAGCCAACCTCGAACCC
CTCGAACCCAATGGCTTCCACGCCATCATCCACCACCCGAAACAGCGTCTCGACCGCATGAATGAGTGGTGCCGG
ACGACACACGGCGCCTCAGGCCTCTCAGCCGCCGTCACAGCCTCAACGACAACAGCCGCCTCAGCAGCGGCAGAC
CTCCTCGCCTACGTGACGCGCCTGGTGCCGGAGCCTCGAAGCGCACTGCTGGCGGGGAACAGCGTGCACGCGGAC
CGGGCATTCCTCCGACGTGAGCCGTTCGCGCCCGTGATCCGGCACCTGCATTACCGGCTGCTCGACGTCAGTGCC
ATCAAGGAGGCTGTTCGGCGGTGGGGGCCCCCGGGAGTGCTGGAGGGGGCGCCGAGGAAGAGGGTGAGGCATTTG
GCTAGGGATGATGTGCTGGAGAGCATTGCCGAGGCTCGCTTCTATCGCGATGCTGTGTTTGGGCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail