Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00200
Gene name
Locationscaffold_01:1163626..1163899
Strand-
Gene length (bp)273
Transcript length (bp)273
Coding sequence length (bp)273
Protein length (aa) 91

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 5 22 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 227.65 101.34 353.96
Alive In ants, during behavior modification 269.22 123.65 414.78
Dead In ants, recently dead 252.86 116.10 389.62

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.526780 no
Alive Dead 0.801210 no
Dead Fungus 0.707656 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00200
MRLSPSYPALLVFIMLFVIAVSARQSPQSSLYSSSANADQDDPSNIVTDDEDHLMRCAARDCKSDAICHLRSGCS
KCFFAKLNTGMGICV*
Coding >Ophcf2|00200
ATGAGACTCTCGCCATCCTATCCCGCTCTCCTGGTCTTCATCATGCTCTTCGTCATCGCTGTCTCGGCACGTCAG
AGCCCGCAGTCGTCGCTTTACTCATCCTCTGCTAACGCTGACCAGGACGACCCGTCCAACATCGTCACTGATGAT
GAAGACCACCTCATGCGCTGCGCAGCTAGGGACTGTAAAAGCGACGCCATCTGCCACCTTCGCAGCGGCTGCTCC
AAGTGTTTCTTCGCAAAACTCAACACCGGCATGGGCATATGCGTCTAG
Transcript >Ophcf2|00200
ATGAGACTCTCGCCATCCTATCCCGCTCTCCTGGTCTTCATCATGCTCTTCGTCATCGCTGTCTCGGCACGTCAG
AGCCCGCAGTCGTCGCTTTACTCATCCTCTGCTAACGCTGACCAGGACGACCCGTCCAACATCGTCACTGATGAT
GAAGACCACCTCATGCGCTGCGCAGCTAGGGACTGTAAAAGCGACGCCATCTGCCACCTTCGCAGCGGCTGCTCC
AAGTGTTTCTTCGCAAAACTCAACACCGGCATGGGCATATGCGTCTAG
Gene >Ophcf2|00200
ATGAGACTCTCGCCATCCTATCCCGCTCTCCTGGTCTTCATCATGCTCTTCGTCATCGCTGTCTCGGCACGTCAG
AGCCCGCAGTCGTCGCTTTACTCATCCTCTGCTAACGCTGACCAGGACGACCCGTCCAACATCGTCACTGATGAT
GAAGACCACCTCATGCGCTGCGCAGCTAGGGACTGTAAAAGCGACGCCATCTGCCACCTTCGCAGCGGCTGCTCC
AAGTGTTTCTTCGCAAAACTCAACACCGGCATGGGCATATGCGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail