Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00198
Gene name
Locationscaffold_01:1157897..1162092
Strand-
Gene length (bp)4195
Transcript length (bp)4014
Coding sequence length (bp)4014
Protein length (aa) 1338

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04108 ATG17_like Autophagy protein ATG17-like domain 5.7E-44 112 454
PF10377 ATG11 Autophagy-related protein 11 1.2E-40 1084 1222

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5014 0.4046 0.2042 0.1031 0.1344 0.0282 0.118 0.3264 0.293 0.0097

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3791
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5381
Ophiocordyceps australis map64 (Brazil) OphauB2|2952
Ophiocordyceps camponoti-floridani Ophcf2|00198 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4198
Ophiocordyceps kimflemingae Ophio5|6550
Ophiocordyceps subramaniannii Hirsu2|7399

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00198
MATQVLIAHTGQRLDVDIAQFSTLDDLKAWIARTSSVSLQHMVALTPQGRSVKFASLLAETEIYVYDIRVTQPSS
TRSGSPSLVLETPSPRRLSIPAAPNSIDDVQAITSWQHLYEERRKWAVNLAESCSRMSKAAAARYDEIDVMIKCM
DAALANLEMSINQIEPKYAELKKWVDPALLEHQRLTAEWEQCLALARTIPVSSTMVEFMTRGQVVKANTTLEDLI
QRDTAKKAGKLAPTAGKRFGDKAAELDKLASHMYQAFEALVADFDKLMNRSVLGHSTDSVQLQQDIEAVVGQIDA
DHRTSLEYGDSQRDLAQASKTASNHTERLVPSLKKRAKEMEEMVQYATRCRNALVHDSAAHMRAITDITALHSSV
KNQINTLNQSESEMTTFDYLRLIQQLPYMYTSFAVEAIRRREWIDKVKSDSSTLANEMALFQDEEAKRRKKWQKM
VGSLYGSNIDGSVMGIEVNLHGESVTWPAVSKDELYDFQQTLHVRGIDASILEDVGKLMQELSSPTKQQSKRLKA
FKNGSVHEASLGRSGLLIRGDDEVLRALQDDKLKLEGRLKTAESRVRRLEDLLHRQSQASRPGNLFQSHKSHQQE
RQEEDGQQGNSEGTEALVRRIEQLENELGREKQHSAELEQDLSARAAQLDDVKHQIQEVNSTKKDLLENMEALKR
EFLDERKSLEEEIKTLKARLEEAEDEMEHIGESREHEQAAYDDKIHALEARMEKQAKEWEDECLKCQGQVEFLRR
ENQMQRSQMEASEQQTHAATTENRSLLRKLETVQAALDSQHQTLAKLHGELVPDASLPTELVDLTESLQSHVGNL
LARLRNSESDSALVKADLGQALESVRELKAEVAELKSRLSSDEAGAKKVRENLSEEQAKVAALDKEAVEVRARLT
ELRGQLSDGETGSEALRKKLEAEEEKAAGLAEELASRQSQLTCLEEQVHAHKQKAERLCGKLTTLTARYESRDSR
TKDLTQRLYTQNDRLVRLLERTGYSVGREEGRMTLNKVPRSERNVGGDPADPGPGLCRSTSLGTRAAADSADLEL
LYWINNADPEVEAGKYEGFVETLGSFDVDLFSETIYLRIKEAEHKARKWYREARSQRDRAHGLHKNARDKIAFKH
FKEGDLALFLPTRNQQLGAWAAFNVGFPHYFLREQDAHRLRHREWLLARISRIQERVVDLSKSLQPTAHDAESVN
DDENDNPFQLSDGLRWYLIDAHEDKPGAPATPGMGKSTLAANKVEATADMHKAKGKNRDSIEGINKTLSKSLDSR
RSSSASKKVPTGVLRNSALASETNSLRDPGTTSPVQGSLDDGETAKASSMLWESLWSVDFRL*
Coding >Ophcf2|00198
ATGGCGACGCAGGTCTTGATCGCCCATACGGGCCAGCGCCTTGACGTCGACATTGCGCAGTTCTCGACTCTCGAT
GATTTGAAGGCCTGGATTGCGCGCACCAGTTCCGTCTCCTTGCAGCACATGGTTGCCCTGACTCCCCAGGGCCGC
AGCGTCAAGTTTGCCAGCCTTCTCGCAGAGACGGAAATCTACGTATACGATATCCGCGTCACACAGCCGTCATCG
ACACGCTCGGGTTCCCCCTCGCTCGTCCTCGAGACTCCTTCACCGAGACGCCTCTCCATACCGGCCGCACCCAAT
TCCATCGATGACGTACAGGCCATCACCTCATGGCAGCATCTGTACGAGGAGCGCCGCAAATGGGCCGTCAACCTG
GCCGAAAGCTGCTCGCGCATGAGCAAAGCCGCCGCAGCTCGCTACGATGAGATTGACGTCATGATAAAGTGTATG
GACGCGGCTCTGGCCAATCTCGAGATGAGCATCAATCAGATCGAGCCCAAATACGCCGAGCTCAAGAAATGGGTG
GACCCGGCTCTGTTGGAGCACCAGCGTCTGACGGCAGAGTGGGAGCAATGCCTCGCCTTGGCCCGGACCATTCCC
GTATCGTCGACCATGGTCGAGTTCATGACCCGGGGTCAGGTCGTCAAGGCCAACACGACGCTCGAGGACCTGATT
CAGCGGGACACGGCCAAAAAGGCGGGCAAGCTCGCACCGACAGCTGGCAAGAGGTTCGGCGATAAAGCCGCCGAG
CTGGACAAGCTGGCATCGCACATGTACCAGGCCTTCGAGGCTCTGGTCGCCGACTTTGACAAGCTGATGAACCGT
TCCGTCCTGGGCCATAGCACCGATTCCGTGCAGCTGCAGCAAGATATCGAAGCCGTCGTCGGCCAGATCGATGCC
GATCATCGTACCTCTCTCGAGTACGGCGACTCGCAGCGCGACCTGGCGCAGGCCTCCAAGACGGCCTCCAACCAC
ACCGAGAGGCTGGTGCCCTCGCTTAAGAAGCGTGCCAAGGAGATGGAGGAAATGGTGCAGTATGCGACACGATGC
CGAAACGCCCTCGTCCACGACTCGGCCGCTCATATGAGGGCCATTACCGACATCACGGCCCTGCACAGCAGCGTC
AAGAACCAGATCAACACGTTGAACCAGTCCGAGTCCGAAATGACGACCTTTGACTATCTCCGCCTCATCCAGCAG
CTGCCATACATGTACACGTCCTTCGCCGTCGAGGCCATCCGTCGCAGGGAATGGATCGACAAGGTCAAGTCGGAC
TCGTCGACGCTCGCCAACGAGATGGCCCTCTTCCAGGATGAGGAAGCCAAGCGGCGGAAGAAGTGGCAAAAGATG
GTCGGCAGCCTGTACGGATCCAACATCGACGGCTCCGTCATGGGGATCGAAGTAAACCTGCATGGAGAGAGCGTG
ACGTGGCCTGCCGTCTCCAAGGACGAGCTGTACGATTTCCAGCAGACTTTGCACGTCCGAGGAATCGATGCCTCC
ATCCTCGAAGACGTGGGCAAACTGATGCAGGAGCTCAGCAGCCCCACGAAACAGCAGTCCAAGAGACTCAAAGCC
TTTAAGAACGGCAGCGTCCACGAGGCCTCGCTGGGACGAAGCGGCCTGTTGATCCGTGGCGACGACGAAGTCTTG
CGTGCGCTTCAAGACGACAAGCTCAAACTCGAGGGCAGATTGAAGACGGCAGAAAGCAGGGTCAGGCGCCTCGAG
GATCTCCTCCACAGACAGAGTCAGGCCTCTCGGCCGGGAAACCTGTTTCAGTCGCACAAGAGTCATCAGCAGGAG
AGGCAAGAGGAAGATGGTCAACAGGGCAACTCGGAGGGGACAGAAGCCTTGGTCCGGCGCATCGAGCAACTCGAG
AACGAACTTGGCCGAGAGAAACAGCACTCTGCCGAGCTCGAGCAGGACCTCAGCGCCCGCGCCGCCCAACTGGAC
GACGTGAAGCATCAGATTCAGGAGGTCAACTCGACCAAGAAGGACTTGCTCGAAAACATGGAAGCTTTGAAGCGC
GAGTTCCTGGACGAGCGCAAGTCGCTGGAAGAGGAGATCAAGACACTCAAGGCCCGGCTCGAAGAGGCCGAGGAC
GAGATGGAGCACATCGGCGAGTCGAGGGAGCACGAACAGGCCGCCTACGACGACAAGATACACGCGCTCGAGGCC
CGGATGGAGAAGCAGGCCAAGGAGTGGGAGGACGAGTGTCTCAAATGTCAGGGCCAGGTCGAGTTCCTGCGAAGG
GAGAACCAGATGCAGCGGAGTCAGATGGAAGCGTCGGAGCAGCAGACGCACGCCGCGACCACGGAGAACCGCTCC
CTGCTGAGGAAGCTCGAGACGGTCCAGGCAGCGCTCGACAGCCAGCACCAGACGCTGGCCAAGCTGCACGGCGAG
CTGGTGCCCGACGCGTCGCTGCCGACGGAGCTCGTGGACCTGACGGAGTCGCTGCAGTCCCACGTGGGCAACCTG
CTGGCTCGGCTCCGGAACTCGGAGAGCGACTCGGCCCTGGTCAAGGCCGACCTCGGACAGGCGCTGGAATCGGTC
AGGGAGCTCAAAGCGGAGGTGGCCGAGCTTAAGAGCAGGCTGTCGAGCGACGAGGCCGGGGCCAAGAAGGTGCGG
GAGAACCTGTCGGAGGAGCAAGCAAAGGTGGCGGCCCTCGACAAGGAGGCTGTCGAGGTGCGGGCCCGTCTCACC
GAGCTACGAGGCCAGCTGTCGGACGGAGAGACGGGTTCCGAGGCGCTCCGCAAGAAGCTCGAGGCCGAGGAAGAG
AAGGCGGCCGGGCTCGCGGAAGAGCTGGCTTCGCGTCAGTCGCAGCTGACCTGCCTCGAGGAGCAAGTCCACGCG
CACAAGCAAAAGGCAGAGAGGCTCTGCGGCAAGCTGACGACGCTGACGGCGCGGTACGAGAGTCGCGACAGCCGG
ACCAAGGACCTGACGCAGCGGCTGTATACGCAGAACGACCGGCTCGTGCGACTCCTGGAGCGGACGGGATACTCG
GTCGGACGAGAGGAGGGACGGATGACCCTCAACAAGGTGCCGCGATCGGAGAGAAACGTCGGCGGCGATCCGGCC
GACCCGGGACCCGGCCTCTGCCGGTCGACGAGCCTCGGGACGCGGGCGGCGGCCGATAGCGCCGATCTGGAGCTG
CTGTACTGGATCAACAACGCCGACCCGGAGGTCGAGGCGGGAAAGTACGAGGGCTTCGTGGAGACGCTCGGCTCG
TTCGACGTCGACCTCTTCTCCGAGACCATCTACCTCCGGATCAAGGAGGCGGAGCACAAGGCGCGCAAGTGGTAT
CGCGAGGCGCGTTCGCAGCGTGACCGGGCTCACGGCCTGCACAAGAACGCGCGCGACAAGATTGCGTTCAAGCAC
TTCAAGGAGGGCGATCTGGCGCTCTTCCTGCCGACGCGCAACCAGCAGCTGGGCGCGTGGGCGGCCTTCAACGTC
GGATTCCCGCACTACTTCCTCCGAGAGCAGGACGCTCACAGGCTGCGTCACCGCGAATGGCTGCTGGCGCGCATC
TCTCGCATCCAGGAACGCGTCGTGGACCTGTCCAAGAGCCTGCAGCCGACGGCTCACGACGCCGAGTCGGTCAAC
GACGACGAGAACGACAACCCCTTCCAGCTGTCGGACGGGCTGCGCTGGTACCTGATTGACGCTCACGAGGACAAG
CCGGGGGCACCGGCGACGCCCGGCATGGGGAAGTCGACGCTGGCTGCCAACAAGGTGGAGGCGACGGCCGACATG
CACAAGGCCAAGGGCAAGAACCGCGACAGCATCGAGGGCATCAACAAGACGCTGTCCAAGAGCCTCGACAGCCGG
CGAAGCAGCTCGGCGTCTAAGAAGGTGCCGACGGGCGTGCTGAGGAACAGCGCGCTGGCCAGCGAGACCAACTCG
CTGCGGGATCCGGGCACGACGAGCCCCGTCCAGGGGAGCCTGGACGACGGCGAGACGGCAAAGGCGTCGTCGATG
CTGTGGGAGTCGCTGTGGAGCGTAGACTTTAGGCTGTAG
Transcript >Ophcf2|00198
ATGGCGACGCAGGTCTTGATCGCCCATACGGGCCAGCGCCTTGACGTCGACATTGCGCAGTTCTCGACTCTCGAT
GATTTGAAGGCCTGGATTGCGCGCACCAGTTCCGTCTCCTTGCAGCACATGGTTGCCCTGACTCCCCAGGGCCGC
AGCGTCAAGTTTGCCAGCCTTCTCGCAGAGACGGAAATCTACGTATACGATATCCGCGTCACACAGCCGTCATCG
ACACGCTCGGGTTCCCCCTCGCTCGTCCTCGAGACTCCTTCACCGAGACGCCTCTCCATACCGGCCGCACCCAAT
TCCATCGATGACGTACAGGCCATCACCTCATGGCAGCATCTGTACGAGGAGCGCCGCAAATGGGCCGTCAACCTG
GCCGAAAGCTGCTCGCGCATGAGCAAAGCCGCCGCAGCTCGCTACGATGAGATTGACGTCATGATAAAGTGTATG
GACGCGGCTCTGGCCAATCTCGAGATGAGCATCAATCAGATCGAGCCCAAATACGCCGAGCTCAAGAAATGGGTG
GACCCGGCTCTGTTGGAGCACCAGCGTCTGACGGCAGAGTGGGAGCAATGCCTCGCCTTGGCCCGGACCATTCCC
GTATCGTCGACCATGGTCGAGTTCATGACCCGGGGTCAGGTCGTCAAGGCCAACACGACGCTCGAGGACCTGATT
CAGCGGGACACGGCCAAAAAGGCGGGCAAGCTCGCACCGACAGCTGGCAAGAGGTTCGGCGATAAAGCCGCCGAG
CTGGACAAGCTGGCATCGCACATGTACCAGGCCTTCGAGGCTCTGGTCGCCGACTTTGACAAGCTGATGAACCGT
TCCGTCCTGGGCCATAGCACCGATTCCGTGCAGCTGCAGCAAGATATCGAAGCCGTCGTCGGCCAGATCGATGCC
GATCATCGTACCTCTCTCGAGTACGGCGACTCGCAGCGCGACCTGGCGCAGGCCTCCAAGACGGCCTCCAACCAC
ACCGAGAGGCTGGTGCCCTCGCTTAAGAAGCGTGCCAAGGAGATGGAGGAAATGGTGCAGTATGCGACACGATGC
CGAAACGCCCTCGTCCACGACTCGGCCGCTCATATGAGGGCCATTACCGACATCACGGCCCTGCACAGCAGCGTC
AAGAACCAGATCAACACGTTGAACCAGTCCGAGTCCGAAATGACGACCTTTGACTATCTCCGCCTCATCCAGCAG
CTGCCATACATGTACACGTCCTTCGCCGTCGAGGCCATCCGTCGCAGGGAATGGATCGACAAGGTCAAGTCGGAC
TCGTCGACGCTCGCCAACGAGATGGCCCTCTTCCAGGATGAGGAAGCCAAGCGGCGGAAGAAGTGGCAAAAGATG
GTCGGCAGCCTGTACGGATCCAACATCGACGGCTCCGTCATGGGGATCGAAGTAAACCTGCATGGAGAGAGCGTG
ACGTGGCCTGCCGTCTCCAAGGACGAGCTGTACGATTTCCAGCAGACTTTGCACGTCCGAGGAATCGATGCCTCC
ATCCTCGAAGACGTGGGCAAACTGATGCAGGAGCTCAGCAGCCCCACGAAACAGCAGTCCAAGAGACTCAAAGCC
TTTAAGAACGGCAGCGTCCACGAGGCCTCGCTGGGACGAAGCGGCCTGTTGATCCGTGGCGACGACGAAGTCTTG
CGTGCGCTTCAAGACGACAAGCTCAAACTCGAGGGCAGATTGAAGACGGCAGAAAGCAGGGTCAGGCGCCTCGAG
GATCTCCTCCACAGACAGAGTCAGGCCTCTCGGCCGGGAAACCTGTTTCAGTCGCACAAGAGTCATCAGCAGGAG
AGGCAAGAGGAAGATGGTCAACAGGGCAACTCGGAGGGGACAGAAGCCTTGGTCCGGCGCATCGAGCAACTCGAG
AACGAACTTGGCCGAGAGAAACAGCACTCTGCCGAGCTCGAGCAGGACCTCAGCGCCCGCGCCGCCCAACTGGAC
GACGTGAAGCATCAGATTCAGGAGGTCAACTCGACCAAGAAGGACTTGCTCGAAAACATGGAAGCTTTGAAGCGC
GAGTTCCTGGACGAGCGCAAGTCGCTGGAAGAGGAGATCAAGACACTCAAGGCCCGGCTCGAAGAGGCCGAGGAC
GAGATGGAGCACATCGGCGAGTCGAGGGAGCACGAACAGGCCGCCTACGACGACAAGATACACGCGCTCGAGGCC
CGGATGGAGAAGCAGGCCAAGGAGTGGGAGGACGAGTGTCTCAAATGTCAGGGCCAGGTCGAGTTCCTGCGAAGG
GAGAACCAGATGCAGCGGAGTCAGATGGAAGCGTCGGAGCAGCAGACGCACGCCGCGACCACGGAGAACCGCTCC
CTGCTGAGGAAGCTCGAGACGGTCCAGGCAGCGCTCGACAGCCAGCACCAGACGCTGGCCAAGCTGCACGGCGAG
CTGGTGCCCGACGCGTCGCTGCCGACGGAGCTCGTGGACCTGACGGAGTCGCTGCAGTCCCACGTGGGCAACCTG
CTGGCTCGGCTCCGGAACTCGGAGAGCGACTCGGCCCTGGTCAAGGCCGACCTCGGACAGGCGCTGGAATCGGTC
AGGGAGCTCAAAGCGGAGGTGGCCGAGCTTAAGAGCAGGCTGTCGAGCGACGAGGCCGGGGCCAAGAAGGTGCGG
GAGAACCTGTCGGAGGAGCAAGCAAAGGTGGCGGCCCTCGACAAGGAGGCTGTCGAGGTGCGGGCCCGTCTCACC
GAGCTACGAGGCCAGCTGTCGGACGGAGAGACGGGTTCCGAGGCGCTCCGCAAGAAGCTCGAGGCCGAGGAAGAG
AAGGCGGCCGGGCTCGCGGAAGAGCTGGCTTCGCGTCAGTCGCAGCTGACCTGCCTCGAGGAGCAAGTCCACGCG
CACAAGCAAAAGGCAGAGAGGCTCTGCGGCAAGCTGACGACGCTGACGGCGCGGTACGAGAGTCGCGACAGCCGG
ACCAAGGACCTGACGCAGCGGCTGTATACGCAGAACGACCGGCTCGTGCGACTCCTGGAGCGGACGGGATACTCG
GTCGGACGAGAGGAGGGACGGATGACCCTCAACAAGGTGCCGCGATCGGAGAGAAACGTCGGCGGCGATCCGGCC
GACCCGGGACCCGGCCTCTGCCGGTCGACGAGCCTCGGGACGCGGGCGGCGGCCGATAGCGCCGATCTGGAGCTG
CTGTACTGGATCAACAACGCCGACCCGGAGGTCGAGGCGGGAAAGTACGAGGGCTTCGTGGAGACGCTCGGCTCG
TTCGACGTCGACCTCTTCTCCGAGACCATCTACCTCCGGATCAAGGAGGCGGAGCACAAGGCGCGCAAGTGGTAT
CGCGAGGCGCGTTCGCAGCGTGACCGGGCTCACGGCCTGCACAAGAACGCGCGCGACAAGATTGCGTTCAAGCAC
TTCAAGGAGGGCGATCTGGCGCTCTTCCTGCCGACGCGCAACCAGCAGCTGGGCGCGTGGGCGGCCTTCAACGTC
GGATTCCCGCACTACTTCCTCCGAGAGCAGGACGCTCACAGGCTGCGTCACCGCGAATGGCTGCTGGCGCGCATC
TCTCGCATCCAGGAACGCGTCGTGGACCTGTCCAAGAGCCTGCAGCCGACGGCTCACGACGCCGAGTCGGTCAAC
GACGACGAGAACGACAACCCCTTCCAGCTGTCGGACGGGCTGCGCTGGTACCTGATTGACGCTCACGAGGACAAG
CCGGGGGCACCGGCGACGCCCGGCATGGGGAAGTCGACGCTGGCTGCCAACAAGGTGGAGGCGACGGCCGACATG
CACAAGGCCAAGGGCAAGAACCGCGACAGCATCGAGGGCATCAACAAGACGCTGTCCAAGAGCCTCGACAGCCGG
CGAAGCAGCTCGGCGTCTAAGAAGGTGCCGACGGGCGTGCTGAGGAACAGCGCGCTGGCCAGCGAGACCAACTCG
CTGCGGGATCCGGGCACGACGAGCCCCGTCCAGGGGAGCCTGGACGACGGCGAGACGGCAAAGGCGTCGTCGATG
CTGTGGGAGTCGCTGTGGAGCGTAGACTTTAGGCTGTAG
Gene >Ophcf2|00198
ATGGCGACGCAGGTCTTGATCGCCCATACGGGCCAGCGCCTTGACGTCGACATTGCGCAGTTCTCGACGTACGCT
CTTCTCCCCCCTTCTATCCGTCTCTCCCCGCTCGATCTCCTGAATCGCGCCCAGTCTCGATGATTTGAAGGCCTG
GATTGCGCGCACCAGTTCCGTCTCCTTGCAGCACATGGTTGCCCTGACTCCCCAGGGCCGCAGCGTCAAGTTTGC
CAGCCTTCTCGCAGAGGTTTGCTCTCCGTGACTTTCTGCTACCCTTGCTAACTTTGAACGCGCAGACGGAAATCT
ACGTATACGATATCCGCGTCACACAGCCGTCATCGACACGCTCGGGTTCCCCCTCGCTCGTCCTCGAGACTCCTT
CACCGAGACGCCTCTCCATACCGGCCGCACCCAATTCCATCGATGACGTACAGGCCATCACCTCATGGCAGCATC
TGTACGAGGAGCGCCGCAAATGGGCCGTCAACCTGGCCGAAAGCTGCTCGCGCATGAGCAAAGCCGCCGCAGCTC
GCTACGATGAGATTGACGTCATGATAAAGTGTATGGACGCGGCTCTGGCCAATCTCGAGATGAGCATCAATCAGA
TCGAGCCCAAATACGCCGAGCTCAAGAAATGGGTGGACCCGGCTCTGTTGGAGCACCAGCGTCTGACGGCAGAGT
GGGAGCAATGCCTCGCCTTGGCCCGGACCATTCCCGTATCGTCGACCATGGTCGAGTTCATGACCCGGGGTCAGG
TCGTCAAGGCCAACACGACGCTCGAGGACCTGATTCAGCGGGACACGGCCAAAAAGGCGGGCAAGCTCGCACCGA
CAGCTGGCAAGAGGTTCGGCGATAAAGCCGCCGAGCTGGACAAGCTGGCATCGCACATGTACCAGGCCTTCGAGG
CTCTGGTCGCCGACTTTGACAAGCTGATGAACCGTTCCGTCCTGGGCCATAGCACCGATTCCGTGCAGCTGCAGC
AAGATATCGAAGCCGTCGTCGGCCAGATCGATGCCGATCATCGTACCTCTCTCGAGTACGGCGACTCGCAGCGCG
ACCTGGCGCAGGCCTCCAAGACGGCCTCCAACCACACCGAGAGGCTGGTGCCCTCGCTTAAGAAGCGTGCCAAGG
AGATGGAGGAAATGGTGCAGTATGCGACACGATGCCGAAACGCCCTCGTCCACGACTCGGCCGCTCATATGAGGG
CCATTACCGACATCACGGCCCTGCACAGCAGCGTCAAGAACCAGATCAACACGTTGAACCAGTCCGAGTCCGAAA
TGACGACCTTTGACTATCTCCGCCTCATCCAGCAGCTGCCATACATGTACACGTCCTTCGCCGTCGAGGCCATCC
GTCGCAGGGAATGGATCGACAAGGTCAAGTCGGACTCGTCGACGCTCGCCAACGAGATGGCCCTCTTCCAGGATG
AGGAAGCCAAGCGGCGGAAGAAGTGGCAAAAGATGGTCGGCAGCCTGTACGGATCCAACATCGACGGCTCCGTCA
TGGGGATCGAAGTAAACCTGCATGGAGAGAGCGTGACGTGGCCTGCCGTCTCCAAGGACGAGCTGTACGATTTCC
AGCAGACTTTGCACGTCCGAGGAATCGATGCCTCCATCCTCGAAGACGTGGGCAAACTGATGCAGGAGCTCAGCA
GCCCCACGAAACAGCAGTCCAAGAGACTCAAAGCCTTTAAGAACGGCAGCGTCCACGAGGCCTCGCTGGGACGAA
GCGGCCTGTTGATCCGTGGCGACGACGAAGTCTTGCGTGCGCTTCAAGACGACAAGCTCAAACTCGAGGGCAGAT
TGAAGACGGCAGAAAGCAGGGTCAGGCGCCTCGAGGATCTCCTCCACAGACAGAGTCAGGCCTCTCGGCCGGGAA
ACCTGTTTCAGTCGCACAAGAGTCATCAGCAGGAGAGGCAAGAGGAAGATGGTCAACAGGGCAACTCGGAGGGGA
CAGAAGCCTTGGTCCGGCGCATCGAGCAACTCGAGAACGAACTTGGCCGAGAGAAACAGCACTCTGCCGAGCTCG
AGCAGGACCTCAGCGCCCGCGCCGCCCAACTGGACGACGTGAAGCATCAGATTCAGGAGGTCAACTCGACCAAGA
AGGACTTGCTCGAAAACATGGAAGCTTTGAAGCGCGAGTTCCTGGACGAGCGCAAGTCGCTGGAAGAGGAGATCA
AGACACTCAAGGCCCGGCTCGAAGAGGCCGAGGACGAGATGGAGCACATCGGCGAGTCGAGGGAGCACGAACAGG
CCGCCTACGACGACAAGATACACGCGCTCGAGGCCCGGATGGAGAAGCAGGCCAAGGAGTGGGAGGACGAGTGTC
TCAAATGTCAGGGCCAGGTCGAGTTCCTGCGAAGGGAGAACCAGATGCAGCGGAGTCAGATGGAAGCGTCGGAGC
AGCAGACGCACGCCGCGACCACGGAGAACCGCTCCCTGCTGAGGAAGCTCGAGACGGTCCAGGCAGCGCTCGACA
GCCAGCACCAGACGCTGGCCAAGCTGCACGGCGAGCTGGTGCCCGACGCGTCGCTGCCGACGGAGCTCGTGGACC
TGACGGAGTCGCTGCAGTCCCACGTGGGCAACCTGCTGGCTCGGCTCCGGAACTCGGAGAGCGACTCGGCCCTGG
TCAAGGCCGACCTCGGACAGGCGCTGGAATCGGTCAGGGAGCTCAAAGCGGAGGTGGCCGAGCTTAAGAGCAGGC
TGTCGAGCGACGAGGCCGGGGCCAAGAAGGTGCGGGAGAACCTGTCGGAGGAGCAAGCAAAGGTGGCGGCCCTCG
ACAAGGAGGCTGTCGAGGTGCGGGCCCGTCTCACCGAGCTACGAGGCCAGCTGTCGGACGGAGAGACGGGTTCCG
AGGCGCTCCGCAAGAAGCTCGAGGCCGAGGAAGAGAAGGCGGCCGGGCTCGCGGAAGAGCTGGCTTCGCGTCAGT
CGCAGCTGACCTGCCTCGAGGAGCAAGTCCACGCGCACAAGCAAAAGGCAGAGAGGCTCTGCGGCAAGCTGACGA
CGCTGACGGCGCGGTACGAGAGTCGCGACAGCCGGACCAAGGACCTGACGCAGCGGCTGTATACGCAGAACGACC
GGCTCGTGCGACTCCTGGAGCGGACGGGATACTCGGTCGGACGAGAGGAGGGACGGATGACCCTCAACAAGGTGC
CGCGATCGGAGAGAAACGTCGGCGGCGATCCGGCCGACCCGGGACCCGGCCTCTGCCGGTCGACGAGCCTCGGGA
CGCGGGCGGCGGCCGATAGCGCCGATCTGGAGCTGCTGTACTGGATCAACAACGCCGACCCGGAGGTCGAGGCGG
GAAAGTACGAGGGCTTCGTGGAGACGCTCGGCTCGTTCGACGTCGACCTCTTCTCCGAGACCATCTACCTCCGGA
TCAAGGAGGCGGAGCACAAGGCGCGCAAGTGGTATCGCGAGGCGCGTTCGCAGCGTGACCGGGCTCACGGCCTGC
ACAAGAACGCGCGCGACAAGATTGCGTTCAAGCACTTCAAGGAGGGCGATCTGGCGCTCTTCCTGCCGACGCGCA
ACCAGCAGCTGGGCGCGTGGGCGGCCTTCAACGTCGGATTCCCGCACTACTTCCTCCGAGAGCAGGACGCTCACA
GGCTGCGTCACCGCGAATGGCTGCTGGCGCGCATCTCTCGCATCCAGGAACGCGTCGTGGACCTGTCCAAGAGCC
TGCAGCCGACGGCTCACGACGCCGAGTCGGTCAACGACGACGAGAACGACAACCCCTTCCAGCTGTCGGACGGGC
TGCGCTGGTACCTGATTGACGCTCACGAGGACAAGCCGGGGGCACCGGCGACGCCCGGCATGGGGAAGTCGACGC
TGGCTGCCAACAAGGTGGAGGCGACGGCCGACATGCACAAGGCCAAGGGCAAGAACCGCGACAGCATCGAGGGCA
TCAACAAGACGCTGTCCAAGAGCCTCGACAGCCGGCGAAGCAGCTCGGCGTCTAAGAAGGTGCCGACGGGCGTGC
TGAGGAACAGCGCGCTGGCCAGCGAGACCAACTCGCTGCGGGATCCGGGCACGACGAGCCCCGTCCAGGGGAGCC
TGGACGACGGCGAGGTACGAAAGGCCGAGTCCCCCTCCCGGGCGATCGGCTGATGACGGGGGCGGTGACGAGGAC
GTATCCGTAGACGGCAAAGGCGTCGTCGATGCTGTGGGAGTCGCTGTGGAGCGTAGACTTTAGGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail