Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00196
Gene name
Locationscaffold_01:1154046..1155798
Strand-
Gene length (bp)1752
Transcript length (bp)1752
Coding sequence length (bp)1752
Protein length (aa) 584

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 1.1E-35 44 416

GO

GO Term Description Terminal node
GO:0016579 protein deubiquitination Yes
GO:0004843 cysteine-type deubiquitinase activity Yes
GO:0044238 primary metabolic process No
GO:0036211 protein modification process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No
GO:0070647 protein modification by small protein conjugation or removal No
GO:0070646 protein modification by small protein removal No
GO:0003824 catalytic activity No
GO:0008234 cysteine-type peptidase activity No
GO:0019538 protein metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0008233 peptidase activity No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0043412 macromolecule modification No
GO:0101005 deubiquitinase activity No
GO:0008150 biological_process No
GO:0006508 proteolysis No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 49.30 28.22 70.38
Alive In ants, during behavior modification 63.35 35.74 90.97
Dead In ants, recently dead 66.42 37.77 95.07

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.189021 no
Alive Dead 0.818244 no
Dead Fungus 0.114628 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00196
MMPDRSVTVVSYAAGASLAAVALIYVFGPTFTIDNDGSRKKTIVGLRNNANDCFINSVLQALAGLGELRTYLIRE
THRRNIEDAAVYQNLVQPDDGVKLEAWKLQGLQMGIVTQGLKDMLDALNERPIAKKSVTPFPFVKVLEAAFKQRI
SRQQQDAQEFLQIVAERLKDEYRAGQRARARARDAPESDGPRGTATGRVSPDQDEPESEPNEGFPMEGKYESRLM
CQTCHYKTKPREEGFCTMTLAVPHVQSTTLNSCFDGIFKTEFIDDFKCEMCRLLQAKANLEHELTRSTSPDFRAQ
ARQNIEKLSAAIDTDPERPPEDVDLGDMRYAPKRRISKTTRMSIFPKILAVHLSRSIYGVGQTTQKNSAKVAFPE
RLPLGGISEPHQYKLLGIITHRGGHNSGHYEAFRRQNQSFPYPNANTFQQSEVYSKASTPVSTPKMRARQVGGGG
SPADSTTDLLSTTAEPPPRSVPAAEASSSSSPAEGRTDGNGDGGSLRSVAASTKSALSKLTAPRQGHDGTPSSSL
RGSLKGPQSAMVGRRAKRRKPTSDKWWRVSDEKVREAKTSEVLGMQREVYMLFYELDD*
Coding >Ophcf2|00196
ATGATGCCGGACCGGTCGGTGACGGTCGTCTCGTACGCGGCCGGTGCCTCCCTTGCCGCCGTCGCCCTCATCTAC
GTCTTCGGCCCGACTTTTACCATCGACAACGACGGTTCCCGCAAGAAGACCATTGTCGGACTGCGCAACAACGCA
AACGATTGCTTCATCAACTCGGTTCTTCAGGCCCTCGCCGGCCTGGGCGAGCTGCGGACGTACCTCATCCGCGAA
ACTCATCGGCGCAACATCGAGGATGCTGCCGTATACCAGAACCTTGTTCAGCCCGATGACGGCGTAAAGCTCGAG
GCCTGGAAGCTACAGGGCCTGCAGATGGGCATCGTCACGCAGGGACTCAAGGATATGTTGGACGCGCTTAATGAG
CGGCCCATTGCCAAGAAGTCGGTGACGCCCTTTCCCTTTGTCAAGGTGCTGGAGGCGGCTTTCAAGCAGCGCATT
AGTAGGCAGCAGCAGGATGCACAAGAGTTTCTTCAGATCGTCGCCGAGCGACTAAAGGACGAGTACCGAGCCGGT
CAGCGCGCCCGCGCCCGCGCCCGCGATGCACCCGAGAGCGATGGGCCTCGCGGGACTGCTACCGGTCGCGTGTCT
CCCGACCAAGACGAGCCCGAGTCGGAGCCCAACGAGGGCTTCCCCATGGAGGGCAAATACGAGTCTCGCCTCATG
TGCCAGACGTGCCACTACAAGACGAAGCCGAGGGAGGAGGGCTTCTGTACCATGACGCTTGCCGTGCCGCACGTG
CAGTCGACGACGCTCAACTCGTGCTTCGACGGCATATTCAAGACGGAGTTCATTGACGACTTCAAGTGCGAAATG
TGCCGCCTCCTGCAGGCCAAGGCCAACCTCGAGCACGAGCTGACACGATCGACGTCGCCTGATTTCCGGGCGCAG
GCACGGCAGAATATCGAGAAGCTCAGCGCTGCCATCGACACGGATCCGGAGCGGCCGCCCGAGGACGTGGACCTG
GGCGACATGCGTTACGCGCCCAAGCGGAGGATCTCAAAGACGACGCGCATGTCCATCTTCCCCAAGATCTTGGCC
GTACACCTGTCGCGATCCATCTACGGCGTCGGACAGACGACGCAGAAGAACTCGGCCAAGGTGGCCTTTCCGGAG
CGGCTGCCGTTGGGCGGCATCTCCGAACCGCACCAGTACAAGCTGCTGGGCATCATCACGCACCGTGGCGGCCAT
AACAGCGGCCACTACGAGGCCTTTCGGCGGCAGAACCAGTCGTTTCCCTACCCCAACGCCAACACGTTTCAGCAG
TCCGAGGTGTACAGCAAGGCTTCGACGCCCGTGTCGACGCCCAAGATGAGGGCCAGACAGGTGGGAGGCGGCGGC
AGCCCGGCCGACTCGACGACGGATCTCCTCTCGACGACGGCCGAGCCGCCCCCGCGCAGCGTCCCGGCAGCCGAG
GCGAGCTCATCGTCGTCACCGGCCGAGGGGCGGACGGACGGCAACGGCGACGGAGGCAGCCTGCGGTCGGTCGCG
GCGTCGACCAAGTCGGCGCTATCGAAGCTGACGGCGCCCAGACAGGGCCACGACGGGACCCCGTCGTCGTCGCTG
AGGGGGAGCCTCAAGGGGCCGCAGTCGGCGATGGTCGGTCGTCGAGCTAAGAGGCGCAAGCCGACGTCGGACAAG
TGGTGGCGCGTCAGCGACGAAAAGGTGCGGGAGGCCAAGACGAGCGAGGTGCTGGGCATGCAGCGAGAGGTGTAC
ATGCTGTTTTACGAGCTGGACGATTAG
Transcript >Ophcf2|00196
ATGATGCCGGACCGGTCGGTGACGGTCGTCTCGTACGCGGCCGGTGCCTCCCTTGCCGCCGTCGCCCTCATCTAC
GTCTTCGGCCCGACTTTTACCATCGACAACGACGGTTCCCGCAAGAAGACCATTGTCGGACTGCGCAACAACGCA
AACGATTGCTTCATCAACTCGGTTCTTCAGGCCCTCGCCGGCCTGGGCGAGCTGCGGACGTACCTCATCCGCGAA
ACTCATCGGCGCAACATCGAGGATGCTGCCGTATACCAGAACCTTGTTCAGCCCGATGACGGCGTAAAGCTCGAG
GCCTGGAAGCTACAGGGCCTGCAGATGGGCATCGTCACGCAGGGACTCAAGGATATGTTGGACGCGCTTAATGAG
CGGCCCATTGCCAAGAAGTCGGTGACGCCCTTTCCCTTTGTCAAGGTGCTGGAGGCGGCTTTCAAGCAGCGCATT
AGTAGGCAGCAGCAGGATGCACAAGAGTTTCTTCAGATCGTCGCCGAGCGACTAAAGGACGAGTACCGAGCCGGT
CAGCGCGCCCGCGCCCGCGCCCGCGATGCACCCGAGAGCGATGGGCCTCGCGGGACTGCTACCGGTCGCGTGTCT
CCCGACCAAGACGAGCCCGAGTCGGAGCCCAACGAGGGCTTCCCCATGGAGGGCAAATACGAGTCTCGCCTCATG
TGCCAGACGTGCCACTACAAGACGAAGCCGAGGGAGGAGGGCTTCTGTACCATGACGCTTGCCGTGCCGCACGTG
CAGTCGACGACGCTCAACTCGTGCTTCGACGGCATATTCAAGACGGAGTTCATTGACGACTTCAAGTGCGAAATG
TGCCGCCTCCTGCAGGCCAAGGCCAACCTCGAGCACGAGCTGACACGATCGACGTCGCCTGATTTCCGGGCGCAG
GCACGGCAGAATATCGAGAAGCTCAGCGCTGCCATCGACACGGATCCGGAGCGGCCGCCCGAGGACGTGGACCTG
GGCGACATGCGTTACGCGCCCAAGCGGAGGATCTCAAAGACGACGCGCATGTCCATCTTCCCCAAGATCTTGGCC
GTACACCTGTCGCGATCCATCTACGGCGTCGGACAGACGACGCAGAAGAACTCGGCCAAGGTGGCCTTTCCGGAG
CGGCTGCCGTTGGGCGGCATCTCCGAACCGCACCAGTACAAGCTGCTGGGCATCATCACGCACCGTGGCGGCCAT
AACAGCGGCCACTACGAGGCCTTTCGGCGGCAGAACCAGTCGTTTCCCTACCCCAACGCCAACACGTTTCAGCAG
TCCGAGGTGTACAGCAAGGCTTCGACGCCCGTGTCGACGCCCAAGATGAGGGCCAGACAGGTGGGAGGCGGCGGC
AGCCCGGCCGACTCGACGACGGATCTCCTCTCGACGACGGCCGAGCCGCCCCCGCGCAGCGTCCCGGCAGCCGAG
GCGAGCTCATCGTCGTCACCGGCCGAGGGGCGGACGGACGGCAACGGCGACGGAGGCAGCCTGCGGTCGGTCGCG
GCGTCGACCAAGTCGGCGCTATCGAAGCTGACGGCGCCCAGACAGGGCCACGACGGGACCCCGTCGTCGTCGCTG
AGGGGGAGCCTCAAGGGGCCGCAGTCGGCGATGGTCGGTCGTCGAGCTAAGAGGCGCAAGCCGACGTCGGACAAG
TGGTGGCGCGTCAGCGACGAAAAGGTGCGGGAGGCCAAGACGAGCGAGGTGCTGGGCATGCAGCGAGAGGTGTAC
ATGCTGTTTTACGAGCTGGACGATTAG
Gene >Ophcf2|00196
ATGATGCCGGACCGGTCGGTGACGGTCGTCTCGTACGCGGCCGGTGCCTCCCTTGCCGCCGTCGCCCTCATCTAC
GTCTTCGGCCCGACTTTTACCATCGACAACGACGGTTCCCGCAAGAAGACCATTGTCGGACTGCGCAACAACGCA
AACGATTGCTTCATCAACTCGGTTCTTCAGGCCCTCGCCGGCCTGGGCGAGCTGCGGACGTACCTCATCCGCGAA
ACTCATCGGCGCAACATCGAGGATGCTGCCGTATACCAGAACCTTGTTCAGCCCGATGACGGCGTAAAGCTCGAG
GCCTGGAAGCTACAGGGCCTGCAGATGGGCATCGTCACGCAGGGACTCAAGGATATGTTGGACGCGCTTAATGAG
CGGCCCATTGCCAAGAAGTCGGTGACGCCCTTTCCCTTTGTCAAGGTGCTGGAGGCGGCTTTCAAGCAGCGCATT
AGTAGGCAGCAGCAGGATGCACAAGAGTTTCTTCAGATCGTCGCCGAGCGACTAAAGGACGAGTACCGAGCCGGT
CAGCGCGCCCGCGCCCGCGCCCGCGATGCACCCGAGAGCGATGGGCCTCGCGGGACTGCTACCGGTCGCGTGTCT
CCCGACCAAGACGAGCCCGAGTCGGAGCCCAACGAGGGCTTCCCCATGGAGGGCAAATACGAGTCTCGCCTCATG
TGCCAGACGTGCCACTACAAGACGAAGCCGAGGGAGGAGGGCTTCTGTACCATGACGCTTGCCGTGCCGCACGTG
CAGTCGACGACGCTCAACTCGTGCTTCGACGGCATATTCAAGACGGAGTTCATTGACGACTTCAAGTGCGAAATG
TGCCGCCTCCTGCAGGCCAAGGCCAACCTCGAGCACGAGCTGACACGATCGACGTCGCCTGATTTCCGGGCGCAG
GCACGGCAGAATATCGAGAAGCTCAGCGCTGCCATCGACACGGATCCGGAGCGGCCGCCCGAGGACGTGGACCTG
GGCGACATGCGTTACGCGCCCAAGCGGAGGATCTCAAAGACGACGCGCATGTCCATCTTCCCCAAGATCTTGGCC
GTACACCTGTCGCGATCCATCTACGGCGTCGGACAGACGACGCAGAAGAACTCGGCCAAGGTGGCCTTTCCGGAG
CGGCTGCCGTTGGGCGGCATCTCCGAACCGCACCAGTACAAGCTGCTGGGCATCATCACGCACCGTGGCGGCCAT
AACAGCGGCCACTACGAGGCCTTTCGGCGGCAGAACCAGTCGTTTCCCTACCCCAACGCCAACACGTTTCAGCAG
TCCGAGGTGTACAGCAAGGCTTCGACGCCCGTGTCGACGCCCAAGATGAGGGCCAGACAGGTGGGAGGCGGCGGC
AGCCCGGCCGACTCGACGACGGATCTCCTCTCGACGACGGCCGAGCCGCCCCCGCGCAGCGTCCCGGCAGCCGAG
GCGAGCTCATCGTCGTCACCGGCCGAGGGGCGGACGGACGGCAACGGCGACGGAGGCAGCCTGCGGTCGGTCGCG
GCGTCGACCAAGTCGGCGCTATCGAAGCTGACGGCGCCCAGACAGGGCCACGACGGGACCCCGTCGTCGTCGCTG
AGGGGGAGCCTCAAGGGGCCGCAGTCGGCGATGGTCGGTCGTCGAGCTAAGAGGCGCAAGCCGACGTCGGACAAG
TGGTGGCGCGTCAGCGACGAAAAGGTGCGGGAGGCCAAGACGAGCGAGGTGCTGGGCATGCAGCGAGAGGTGTAC
ATGCTGTTTTACGAGCTGGACGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail