Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00193
Gene name
Locationscaffold_01:1139509..1145361
Strand+
Gene length (bp)5852
Transcript length (bp)5550
Coding sequence length (bp)5550
Protein length (aa) 1850

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04118 Dopey_N Dopey, N-terminal 2.6E-112 37 362

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5122 0.489 0.3209 0.1008 0.0848 0.0222 0.1957 0.1646 0.2269 0.0249

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 17.93 10.30 25.57
Alive In ants, during behavior modification 12.60 7.07 18.12
Dead In ants, recently dead 10.20 5.58 14.81

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.054473 no
Alive Dead 0.217291 no
Dead Fungus 0.001409 yes

Orthologs

Orthofinder run ID4
Orthogroup4686
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6222
Ophiocordyceps australis map64 (Brazil) OphauB2|292
Ophiocordyceps camponoti-floridani Ophcf2|00193 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3429
Ophiocordyceps kimflemingae Ophio5|4389
Ophiocordyceps subramaniannii Hirsu2|9876

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00193
MALEQASGVYSASPESSGRNSPVPRGWKSQDELPVKDKAYRKYASGVEKVLSQFETALEEWADYISFLNRLLKSL
QARPASITTIPAKGVVAKRLSQCLNPALPSGVHQKALEVYSYVFSVIGKEGLSRHIPLYLPGLAPTLSFASLSVR
APFLDLVETHVLRADPRSLRPATKCIILALLPGLEDETSEDFDRTLNIVTDFKKAIRPPDSQHIDQNHSSGDAFF
WQCFFLASMTGHGRRSGALAYLNRCLPVLAPVPSSGPPVATSGDEEDDSSKMALVVTSPEPGLLVRCFSSGLADP
QLLIQRGFLDLLVSHLPLNSSVLRSRVKPVDLKLLVEAAAGVVTRRDMSLNRRLWAWLLGPEPAGNEGESAGDPT
TPSREQQQQQQQQQQQQQQSFLSPKTNYFEEFGLQPLTKALLDMIKGAASGTAAERARPYRICLSLMDKWEIGGL
VVPQVFLPVVESVQQYQSRAPAKADFAEVLRSASVFFDGIESGLIFSEMFRLLAQALGVESSSMDERSDRISLVA
FIVANFNVREEDMVTIHGPLTCLATLSMLEHLQTRTAKSGLAASEMVKLSEQALNVIVSLVELVPDRAFPASRKE
VASSLSMAKSDILKKLRTFYLELHGNLDSSPPPFEAVECGELLLNKAVEYTYDNGDDGSAPCSNEDLGLRVRVFT
LMLLKTPTSYRFDVERSMSHLKAQLQQTCPLPFSHLSSVLHLATQLYSAERIDAKQLSEMVGPLVRHAWSYLASS
DPKYHVETVRCLWQLQTALTPWNREMEAALCSILVDAPVFAEAARTFGVLWSHTLQDTAGDRRAPRTPMHEYRST
PRLSGMEHYPVMLTQPLFLVLDALLDERTQAYMVVKSWLNNTIGIDRLFLLFVTKLSELSFLSDVGSESGKTNGA
DPIIFGRDDDLDLCLYYLRTLHFVLACTGDVSRSVLASRYLSFGGGQTQIRGSAEEGDMTLQDYFVRVCAECVTG
EVTSGADQDLTEQVSQLRRYALMILHQFLSSRHAASIAHHHLDKVLLDRLAKSISTPDPYVQVLLLEVMLDSLKL
QEASQGERPPTATSERMSSMTDRARAGRTSGSVSDSSPAGPQMPPQLLKCLQAGLSCPGSHSVLDSWISFLGDCL
PFFAHSIFQILIPLVETVCKQIGQTLSDLRNTFQAEPRLAGSKGSAPETALFYLLNGLERVLALAHDQLLTEETR
ARLLKGPEQTQSLLGSMVSGVFQSESAQSRSATANDRLTVHLAFQDTMRTCYDIWSWGQGDEARKQDVGSLASFN
YTSLRMRNRARRLLEHLFAAETLECLETVIGIWRSASGEGERAQVFKFLSALDACRPRHCVPALFNSIYSRTNPG
ALDPSRKSAMTIALQDLDLVVFLVEYARSLEDDAMDEIWADCMTFLRDLLGNPFPHRQTLPSLLEFAGILGEKVD
NTNFGEQRRMRRELSDLFLRLLAALFTTRPMTFSEPNGAADKSMSSSINRRRTLSSGGDSGDDVVRVLASIVPKL
PQILVENDRVASAAATISTNVMGPALRSRAFPDTFSPRLLRLLLELSRLQGGHKAWKKDVSEAFNDGRFLATRAD
VVEAEWLPLLRQWMLADKDRVTEMMSRIGAPTTAGIVFGVGATSARLEADRRTQLNVRRAATLVLAAANDGLVSE
LPLVLDKMTELLTATPVSSPSSTTRADIFQLVRALALKTSPLHLASLWPVINAEMQAVLSSVADADDDSYTSAAV
VEACKLLDLLLCVAPDDFQLHEWLFVTDTIDALHRPSSYQPVALVDDLALNLSTTTKTTNPTFTTTTITTTTMIK
NTPQAAKDDDDDDDDDDGHHHHHHHHHHHHRRLPSSSPSRQQQQNPARG*
Coding >Ophcf2|00193
ATGGCTCTTGAGCAGGCATCCGGCGTCTACTCGGCGTCTCCCGAAAGCTCCGGGCGCAATTCGCCCGTGCCCCGA
GGCTGGAAGAGCCAAGACGAGCTGCCGGTAAAGGACAAGGCCTATCGCAAGTATGCTTCGGGCGTCGAAAAGGTC
CTGTCGCAGTTCGAGACGGCCTTGGAGGAATGGGCCGACTACATCTCTTTTCTAAACAGACTGCTCAAGTCTCTA
CAGGCTCGGCCCGCATCCATAACGACGATACCAGCCAAGGGCGTCGTCGCCAAACGTCTGTCGCAGTGCCTCAAT
CCCGCCCTGCCGTCGGGCGTTCATCAAAAGGCCCTTGAAGTCTACAGCTACGTTTTTTCCGTCATTGGAAAAGAA
GGACTGTCCCGACACATTCCTCTATATTTACCAGGACTCGCACCCACCTTGTCCTTTGCCTCGCTCTCCGTGAGG
GCTCCCTTCCTCGATCTCGTGGAGACACACGTCCTGAGAGCCGACCCGCGCTCTCTTCGGCCGGCCACCAAATGC
ATAATATTGGCTTTACTCCCGGGCCTGGAGGACGAGACGAGCGAAGATTTCGATCGCACCCTGAACATCGTCACC
GACTTCAAGAAAGCTATCCGGCCACCGGACAGCCAACATATTGATCAAAATCACTCTTCCGGGGATGCCTTTTTC
TGGCAATGCTTCTTCTTGGCATCCATGACGGGTCACGGCCGTCGCTCCGGTGCTTTGGCATACCTGAATCGCTGT
CTCCCCGTCCTGGCCCCCGTCCCGTCCAGCGGCCCTCCCGTTGCCACCTCTGGAGACGAAGAGGACGACAGCTCC
AAGATGGCGCTCGTCGTGACCTCTCCCGAGCCAGGGCTCTTGGTACGCTGCTTTTCCAGTGGTCTGGCGGATCCG
CAGCTGCTCATTCAACGCGGCTTCCTCGACCTCTTGGTATCCCATTTACCCCTGAACTCGAGTGTGCTGCGGTCC
CGTGTGAAGCCTGTCGACCTCAAGCTGCTTGTCGAGGCCGCCGCCGGAGTCGTGACGCGGCGGGACATGAGCTTG
AACAGGCGGTTGTGGGCATGGCTTCTCGGTCCCGAGCCGGCCGGCAACGAAGGCGAGAGTGCCGGCGATCCGACG
ACGCCGTCCCGTGAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGTCGTTCCTCTCGCCCAAG
ACCAACTACTTTGAGGAGTTTGGGCTACAGCCGCTGACCAAGGCCTTACTGGATATGATCAAGGGGGCTGCCAGC
GGCACCGCTGCCGAACGAGCTCGACCGTACCGCATCTGTCTCTCCCTGATGGACAAGTGGGAGATTGGGGGTCTC
GTCGTTCCCCAGGTCTTTCTGCCCGTGGTGGAGAGCGTGCAGCAGTATCAGAGCCGAGCGCCGGCAAAGGCTGAT
TTCGCCGAGGTCCTGCGCAGTGCCAGCGTCTTCTTCGACGGTATCGAGAGCGGTCTCATTTTTAGCGAGATGTTC
CGGCTGCTGGCCCAGGCCTTGGGCGTCGAGAGCAGCAGCATGGACGAGCGGAGCGACAGAATCTCTCTAGTGGCC
TTTATCGTGGCAAACTTCAACGTCCGTGAAGAAGACATGGTAACAATCCACGGCCCTCTCACCTGTCTGGCTACC
CTGTCGATGCTGGAGCACCTGCAGACCCGCACAGCCAAGTCTGGCCTGGCGGCGTCCGAGATGGTCAAGCTCTCT
GAGCAGGCTCTGAATGTGATCGTGTCGTTGGTGGAGCTGGTGCCGGACCGCGCATTTCCAGCCAGCCGGAAAGAA
GTCGCCTCCTCTCTGTCGATGGCCAAGTCGGATATACTGAAGAAGCTCAGGACCTTCTATCTGGAGCTCCACGGT
AACCTCGACTCGTCGCCGCCACCGTTTGAAGCGGTCGAATGCGGAGAGCTGCTGCTGAACAAGGCCGTCGAATAC
ACGTACGATAATGGCGATGATGGCTCGGCACCATGCTCCAACGAGGACCTGGGCTTACGCGTCCGCGTCTTTACG
CTGATGCTGCTCAAGACGCCGACGAGCTACAGATTCGACGTTGAAAGGTCCATGTCGCACCTCAAGGCTCAGCTA
CAGCAGACGTGCCCGCTGCCCTTTTCCCATCTGTCGTCGGTTCTGCACCTCGCCACGCAGCTCTACTCGGCCGAG
AGGATCGACGCGAAGCAGCTCTCAGAGATGGTGGGCCCCCTCGTCCGCCACGCGTGGTCTTACCTGGCATCGTCG
GATCCGAAATACCACGTTGAGACGGTCCGTTGCCTGTGGCAGCTTCAGACGGCCCTCACGCCGTGGAATCGCGAG
ATGGAAGCCGCTCTCTGCAGTATCCTGGTAGACGCCCCGGTGTTTGCGGAAGCCGCACGCACCTTTGGCGTGCTC
TGGTCGCATACGCTTCAGGACACGGCTGGCGACCGGCGAGCGCCTCGGACGCCTATGCACGAGTATCGATCTACT
CCCAGGCTTTCCGGCATGGAGCACTATCCGGTCATGCTGACGCAGCCCCTGTTCCTCGTCCTAGACGCCTTGCTG
GACGAGCGGACGCAAGCCTACATGGTGGTCAAGTCGTGGCTCAACAACACCATCGGGATAGACAGGCTCTTCCTT
CTCTTCGTCACCAAGCTCTCCGAGCTGTCTTTTCTGTCGGATGTCGGAAGCGAGAGCGGCAAGACAAACGGTGCC
GACCCCATCATCTTCGGCCGAGACGATGACTTGGATCTCTGTCTGTACTATCTGCGGACTCTTCACTTCGTTCTC
GCCTGTACCGGCGACGTTTCTCGCTCTGTATTGGCGTCTAGATATCTCTCCTTTGGCGGCGGACAGACGCAAATA
CGTGGTAGCGCCGAGGAGGGCGATATGACGCTGCAGGACTACTTCGTCCGCGTATGCGCTGAATGCGTCACGGGA
GAGGTGACATCTGGCGCCGACCAGGACTTGACCGAGCAGGTCTCTCAGCTGCGTCGATACGCGCTGATGATCCTT
CATCAGTTCCTGTCGAGCCGCCATGCCGCATCTATCGCCCATCATCACCTCGACAAGGTCCTTTTGGACAGGCTT
GCCAAGTCGATCAGTACGCCGGATCCATACGTCCAGGTGCTGCTGCTGGAAGTGATGCTCGACAGCCTCAAGCTG
CAGGAGGCTTCGCAAGGGGAGCGACCACCGACGGCGACGTCGGAGAGGATGTCTTCGATGACGGACCGAGCTCGG
GCCGGCCGGACGTCGGGCTCCGTGAGCGACAGCTCCCCGGCCGGACCTCAGATGCCTCCTCAGCTTCTCAAGTGT
CTGCAGGCCGGTCTCAGCTGTCCCGGCAGCCACTCGGTGCTGGACAGCTGGATATCCTTCTTGGGGGACTGCCTT
CCGTTCTTCGCCCACTCCATCTTCCAGATCCTGATTCCGCTCGTCGAGACGGTCTGCAAACAGATAGGGCAGACG
CTGTCGGATCTTCGCAACACGTTCCAGGCCGAGCCACGGCTGGCCGGCAGCAAGGGCAGCGCGCCCGAGACGGCG
CTCTTCTACCTGCTCAACGGGCTGGAGCGGGTGCTGGCTCTGGCGCACGATCAACTGCTGACGGAGGAGACGCGA
GCGCGGCTGTTGAAGGGGCCCGAGCAGACGCAGTCTCTCCTGGGAAGCATGGTTTCGGGCGTCTTTCAGTCGGAG
AGCGCGCAGTCTCGGAGCGCTACGGCGAACGACCGGCTGACGGTGCACCTGGCCTTCCAGGACACGATGAGGACG
TGCTACGACATCTGGTCGTGGGGCCAGGGAGACGAGGCGAGGAAGCAGGACGTCGGGTCGCTGGCGTCGTTCAAC
TACACGTCTCTTCGGATGAGGAACCGGGCCCGACGACTGCTGGAGCACCTGTTCGCGGCCGAGACGCTCGAGTGT
CTGGAGACGGTGATTGGCATCTGGCGGTCGGCGTCCGGGGAGGGCGAGCGGGCCCAGGTCTTCAAGTTCCTGTCG
GCCCTCGACGCCTGTCGGCCGAGGCACTGCGTCCCGGCGCTGTTCAACTCGATATACAGCCGGACGAACCCGGGC
GCGCTGGACCCGTCTCGAAAGTCGGCCATGACGATTGCGCTGCAGGACCTGGACCTGGTGGTGTTTCTGGTCGAG
TACGCGCGCTCGCTCGAAGACGACGCCATGGACGAGATCTGGGCCGACTGTATGACGTTTCTGCGAGACCTACTG
GGCAACCCATTTCCTCACCGGCAGACGCTACCGAGCCTACTCGAGTTCGCCGGCATCCTGGGCGAGAAGGTGGAC
AATACCAACTTTGGAGAGCAGCGGAGGATGCGGCGCGAGCTGAGTGATCTCTTCCTCCGCCTCCTGGCCGCCCTC
TTCACCACGCGGCCCATGACGTTTTCAGAGCCCAACGGAGCGGCGGACAAGTCCATGTCGTCATCCATCAACCGG
CGAAGGACACTGAGCAGCGGCGGCGACAGCGGCGACGACGTGGTACGGGTGCTGGCGTCCATCGTGCCCAAGCTG
CCGCAGATCCTGGTAGAGAACGACCGGGTGGCGTCGGCAGCAGCCACCATCTCAACCAACGTCATGGGCCCAGCC
CTGCGATCGCGAGCCTTCCCAGACACCTTCTCGCCCCGTCTACTGCGGCTGCTACTAGAGTTGTCACGGCTTCAG
GGCGGACACAAGGCATGGAAGAAGGACGTGAGCGAAGCCTTCAACGACGGCCGGTTCCTGGCCACGCGCGCCGAC
GTGGTTGAGGCGGAGTGGCTGCCGCTGCTCCGGCAATGGATGCTGGCGGATAAGGACCGAGTCACCGAGATGATG
AGCCGGATCGGAGCCCCGACGACAGCCGGCATCGTCTTCGGCGTCGGCGCCACCTCGGCCCGGCTCGAAGCCGAT
CGCCGAACTCAACTCAACGTCCGACGAGCAGCGACTTTGGTCCTGGCAGCCGCCAACGACGGACTCGTCTCGGAA
CTGCCTCTCGTGCTGGATAAGATGACGGAACTCCTGACGGCGACGCCCGTCTCGTCCCCCTCGTCAACCACCCGA
GCAGACATCTTCCAGCTCGTACGCGCCCTAGCCCTCAAGACAAGTCCCCTACACCTAGCCTCCCTCTGGCCCGTC
ATCAACGCCGAAATGCAAGCCGTCCTCTCTTCCGTCGCCGACGCCGACGACGACTCCTACACCTCTGCCGCCGTC
GTCGAGGCCTGCAAGCTCCTCGATCTTCTCCTATGCGTCGCGCCCGATGACTTTCAGCTCCATGAATGGCTCTTC
GTCACGGATACCATTGACGCTCTTCACCGTCCATCTTCGTACCAACCCGTCGCGCTGGTGGATGATCTGGCCCTC
AACCTCTCAACCACGACCAAAACTACGAATCCAACTTTCACCACCACCACCATCACCACCACCACCATGATCAAA
AACACCCCGCAGGCAGCAAAAGACGACGACGACGACGACGACGACGACGACGGTCACCACCACCACCACCACCAC
CACCACCATCACCATCGCCGCCTCCCCTCCTCCTCTCCATCCCGTCAGCAGCAACAGAATCCCGCGCGGGGCTGA
Transcript >Ophcf2|00193
ATGGCTCTTGAGCAGGCATCCGGCGTCTACTCGGCGTCTCCCGAAAGCTCCGGGCGCAATTCGCCCGTGCCCCGA
GGCTGGAAGAGCCAAGACGAGCTGCCGGTAAAGGACAAGGCCTATCGCAAGTATGCTTCGGGCGTCGAAAAGGTC
CTGTCGCAGTTCGAGACGGCCTTGGAGGAATGGGCCGACTACATCTCTTTTCTAAACAGACTGCTCAAGTCTCTA
CAGGCTCGGCCCGCATCCATAACGACGATACCAGCCAAGGGCGTCGTCGCCAAACGTCTGTCGCAGTGCCTCAAT
CCCGCCCTGCCGTCGGGCGTTCATCAAAAGGCCCTTGAAGTCTACAGCTACGTTTTTTCCGTCATTGGAAAAGAA
GGACTGTCCCGACACATTCCTCTATATTTACCAGGACTCGCACCCACCTTGTCCTTTGCCTCGCTCTCCGTGAGG
GCTCCCTTCCTCGATCTCGTGGAGACACACGTCCTGAGAGCCGACCCGCGCTCTCTTCGGCCGGCCACCAAATGC
ATAATATTGGCTTTACTCCCGGGCCTGGAGGACGAGACGAGCGAAGATTTCGATCGCACCCTGAACATCGTCACC
GACTTCAAGAAAGCTATCCGGCCACCGGACAGCCAACATATTGATCAAAATCACTCTTCCGGGGATGCCTTTTTC
TGGCAATGCTTCTTCTTGGCATCCATGACGGGTCACGGCCGTCGCTCCGGTGCTTTGGCATACCTGAATCGCTGT
CTCCCCGTCCTGGCCCCCGTCCCGTCCAGCGGCCCTCCCGTTGCCACCTCTGGAGACGAAGAGGACGACAGCTCC
AAGATGGCGCTCGTCGTGACCTCTCCCGAGCCAGGGCTCTTGGTACGCTGCTTTTCCAGTGGTCTGGCGGATCCG
CAGCTGCTCATTCAACGCGGCTTCCTCGACCTCTTGGTATCCCATTTACCCCTGAACTCGAGTGTGCTGCGGTCC
CGTGTGAAGCCTGTCGACCTCAAGCTGCTTGTCGAGGCCGCCGCCGGAGTCGTGACGCGGCGGGACATGAGCTTG
AACAGGCGGTTGTGGGCATGGCTTCTCGGTCCCGAGCCGGCCGGCAACGAAGGCGAGAGTGCCGGCGATCCGACG
ACGCCGTCCCGTGAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGTCGTTCCTCTCGCCCAAG
ACCAACTACTTTGAGGAGTTTGGGCTACAGCCGCTGACCAAGGCCTTACTGGATATGATCAAGGGGGCTGCCAGC
GGCACCGCTGCCGAACGAGCTCGACCGTACCGCATCTGTCTCTCCCTGATGGACAAGTGGGAGATTGGGGGTCTC
GTCGTTCCCCAGGTCTTTCTGCCCGTGGTGGAGAGCGTGCAGCAGTATCAGAGCCGAGCGCCGGCAAAGGCTGAT
TTCGCCGAGGTCCTGCGCAGTGCCAGCGTCTTCTTCGACGGTATCGAGAGCGGTCTCATTTTTAGCGAGATGTTC
CGGCTGCTGGCCCAGGCCTTGGGCGTCGAGAGCAGCAGCATGGACGAGCGGAGCGACAGAATCTCTCTAGTGGCC
TTTATCGTGGCAAACTTCAACGTCCGTGAAGAAGACATGGTAACAATCCACGGCCCTCTCACCTGTCTGGCTACC
CTGTCGATGCTGGAGCACCTGCAGACCCGCACAGCCAAGTCTGGCCTGGCGGCGTCCGAGATGGTCAAGCTCTCT
GAGCAGGCTCTGAATGTGATCGTGTCGTTGGTGGAGCTGGTGCCGGACCGCGCATTTCCAGCCAGCCGGAAAGAA
GTCGCCTCCTCTCTGTCGATGGCCAAGTCGGATATACTGAAGAAGCTCAGGACCTTCTATCTGGAGCTCCACGGT
AACCTCGACTCGTCGCCGCCACCGTTTGAAGCGGTCGAATGCGGAGAGCTGCTGCTGAACAAGGCCGTCGAATAC
ACGTACGATAATGGCGATGATGGCTCGGCACCATGCTCCAACGAGGACCTGGGCTTACGCGTCCGCGTCTTTACG
CTGATGCTGCTCAAGACGCCGACGAGCTACAGATTCGACGTTGAAAGGTCCATGTCGCACCTCAAGGCTCAGCTA
CAGCAGACGTGCCCGCTGCCCTTTTCCCATCTGTCGTCGGTTCTGCACCTCGCCACGCAGCTCTACTCGGCCGAG
AGGATCGACGCGAAGCAGCTCTCAGAGATGGTGGGCCCCCTCGTCCGCCACGCGTGGTCTTACCTGGCATCGTCG
GATCCGAAATACCACGTTGAGACGGTCCGTTGCCTGTGGCAGCTTCAGACGGCCCTCACGCCGTGGAATCGCGAG
ATGGAAGCCGCTCTCTGCAGTATCCTGGTAGACGCCCCGGTGTTTGCGGAAGCCGCACGCACCTTTGGCGTGCTC
TGGTCGCATACGCTTCAGGACACGGCTGGCGACCGGCGAGCGCCTCGGACGCCTATGCACGAGTATCGATCTACT
CCCAGGCTTTCCGGCATGGAGCACTATCCGGTCATGCTGACGCAGCCCCTGTTCCTCGTCCTAGACGCCTTGCTG
GACGAGCGGACGCAAGCCTACATGGTGGTCAAGTCGTGGCTCAACAACACCATCGGGATAGACAGGCTCTTCCTT
CTCTTCGTCACCAAGCTCTCCGAGCTGTCTTTTCTGTCGGATGTCGGAAGCGAGAGCGGCAAGACAAACGGTGCC
GACCCCATCATCTTCGGCCGAGACGATGACTTGGATCTCTGTCTGTACTATCTGCGGACTCTTCACTTCGTTCTC
GCCTGTACCGGCGACGTTTCTCGCTCTGTATTGGCGTCTAGATATCTCTCCTTTGGCGGCGGACAGACGCAAATA
CGTGGTAGCGCCGAGGAGGGCGATATGACGCTGCAGGACTACTTCGTCCGCGTATGCGCTGAATGCGTCACGGGA
GAGGTGACATCTGGCGCCGACCAGGACTTGACCGAGCAGGTCTCTCAGCTGCGTCGATACGCGCTGATGATCCTT
CATCAGTTCCTGTCGAGCCGCCATGCCGCATCTATCGCCCATCATCACCTCGACAAGGTCCTTTTGGACAGGCTT
GCCAAGTCGATCAGTACGCCGGATCCATACGTCCAGGTGCTGCTGCTGGAAGTGATGCTCGACAGCCTCAAGCTG
CAGGAGGCTTCGCAAGGGGAGCGACCACCGACGGCGACGTCGGAGAGGATGTCTTCGATGACGGACCGAGCTCGG
GCCGGCCGGACGTCGGGCTCCGTGAGCGACAGCTCCCCGGCCGGACCTCAGATGCCTCCTCAGCTTCTCAAGTGT
CTGCAGGCCGGTCTCAGCTGTCCCGGCAGCCACTCGGTGCTGGACAGCTGGATATCCTTCTTGGGGGACTGCCTT
CCGTTCTTCGCCCACTCCATCTTCCAGATCCTGATTCCGCTCGTCGAGACGGTCTGCAAACAGATAGGGCAGACG
CTGTCGGATCTTCGCAACACGTTCCAGGCCGAGCCACGGCTGGCCGGCAGCAAGGGCAGCGCGCCCGAGACGGCG
CTCTTCTACCTGCTCAACGGGCTGGAGCGGGTGCTGGCTCTGGCGCACGATCAACTGCTGACGGAGGAGACGCGA
GCGCGGCTGTTGAAGGGGCCCGAGCAGACGCAGTCTCTCCTGGGAAGCATGGTTTCGGGCGTCTTTCAGTCGGAG
AGCGCGCAGTCTCGGAGCGCTACGGCGAACGACCGGCTGACGGTGCACCTGGCCTTCCAGGACACGATGAGGACG
TGCTACGACATCTGGTCGTGGGGCCAGGGAGACGAGGCGAGGAAGCAGGACGTCGGGTCGCTGGCGTCGTTCAAC
TACACGTCTCTTCGGATGAGGAACCGGGCCCGACGACTGCTGGAGCACCTGTTCGCGGCCGAGACGCTCGAGTGT
CTGGAGACGGTGATTGGCATCTGGCGGTCGGCGTCCGGGGAGGGCGAGCGGGCCCAGGTCTTCAAGTTCCTGTCG
GCCCTCGACGCCTGTCGGCCGAGGCACTGCGTCCCGGCGCTGTTCAACTCGATATACAGCCGGACGAACCCGGGC
GCGCTGGACCCGTCTCGAAAGTCGGCCATGACGATTGCGCTGCAGGACCTGGACCTGGTGGTGTTTCTGGTCGAG
TACGCGCGCTCGCTCGAAGACGACGCCATGGACGAGATCTGGGCCGACTGTATGACGTTTCTGCGAGACCTACTG
GGCAACCCATTTCCTCACCGGCAGACGCTACCGAGCCTACTCGAGTTCGCCGGCATCCTGGGCGAGAAGGTGGAC
AATACCAACTTTGGAGAGCAGCGGAGGATGCGGCGCGAGCTGAGTGATCTCTTCCTCCGCCTCCTGGCCGCCCTC
TTCACCACGCGGCCCATGACGTTTTCAGAGCCCAACGGAGCGGCGGACAAGTCCATGTCGTCATCCATCAACCGG
CGAAGGACACTGAGCAGCGGCGGCGACAGCGGCGACGACGTGGTACGGGTGCTGGCGTCCATCGTGCCCAAGCTG
CCGCAGATCCTGGTAGAGAACGACCGGGTGGCGTCGGCAGCAGCCACCATCTCAACCAACGTCATGGGCCCAGCC
CTGCGATCGCGAGCCTTCCCAGACACCTTCTCGCCCCGTCTACTGCGGCTGCTACTAGAGTTGTCACGGCTTCAG
GGCGGACACAAGGCATGGAAGAAGGACGTGAGCGAAGCCTTCAACGACGGCCGGTTCCTGGCCACGCGCGCCGAC
GTGGTTGAGGCGGAGTGGCTGCCGCTGCTCCGGCAATGGATGCTGGCGGATAAGGACCGAGTCACCGAGATGATG
AGCCGGATCGGAGCCCCGACGACAGCCGGCATCGTCTTCGGCGTCGGCGCCACCTCGGCCCGGCTCGAAGCCGAT
CGCCGAACTCAACTCAACGTCCGACGAGCAGCGACTTTGGTCCTGGCAGCCGCCAACGACGGACTCGTCTCGGAA
CTGCCTCTCGTGCTGGATAAGATGACGGAACTCCTGACGGCGACGCCCGTCTCGTCCCCCTCGTCAACCACCCGA
GCAGACATCTTCCAGCTCGTACGCGCCCTAGCCCTCAAGACAAGTCCCCTACACCTAGCCTCCCTCTGGCCCGTC
ATCAACGCCGAAATGCAAGCCGTCCTCTCTTCCGTCGCCGACGCCGACGACGACTCCTACACCTCTGCCGCCGTC
GTCGAGGCCTGCAAGCTCCTCGATCTTCTCCTATGCGTCGCGCCCGATGACTTTCAGCTCCATGAATGGCTCTTC
GTCACGGATACCATTGACGCTCTTCACCGTCCATCTTCGTACCAACCCGTCGCGCTGGTGGATGATCTGGCCCTC
AACCTCTCAACCACGACCAAAACTACGAATCCAACTTTCACCACCACCACCATCACCACCACCACCATGATCAAA
AACACCCCGCAGGCAGCAAAAGACGACGACGACGACGACGACGACGACGACGGTCACCACCACCACCACCACCAC
CACCACCATCACCATCGCCGCCTCCCCTCCTCCTCTCCATCCCGTCAGCAGCAACAGAATCCCGCGCGGGGCTGA
Gene >Ophcf2|00193
ATGGCTCTTGAGCAGGCATCCGGCGTCTACTCGGCGTCTCCCGAAAGCTCCGGGCGCAATTCGCCCGTGCCCCGA
GGCTGGAAGAGCCAAGGTGGGCGCCTCTGCCAATGTCATCGCCCGTCACCATCTGACCCGAAGATACAGACGAGC
TGCCGGTAAAGGACAAGGCCTATCGCAAGTATGCTTCGGGCGTCGAAAAGGTCCTGTCGCAGTTCGAGACGGCCT
TGGAGGAATGGGCCGACTACATCTCTTTTCTAAACAGACTGCTCAAGGTATCGATCAGCTGCCTCTTCATTCATG
CGCTCATGGCACTCACAATTTACTATTCAGTCTCTACAGGCTCGGCCCGCATCCATAACGACGATACCAGCCAAG
GGCGTCGTCGCCAAACGTCTGTCGCAGTGCCTCAATCCCGCCCTGCCGTCGGGCGTTCATCAAAAGGCCCTTGAA
GTCTACAGCTACGTTTTTTCCGTCATTGGAAAAGAAGGACTGTCCCGACACATTCCTCTATATTTACCAGGACTC
GCACCCACCTTGTCCTTTGCCTCGCTCTCCGTGAGGGCTCCCTTCCTCGATCTCGTGGAGACACACGTCCTGAGA
GCCGACCCGCGCTCTCTTCGGCCGGCCACCAAATGCATAATATTGGCTTTACTCCCGGGCCTGGAGGACGAGACG
AGCGAAGATTTCGATCGCACCCTGAACATCGTCACCGACTTCAAGAAAGCTATCCGGCCACCGGACAGCCAACAT
ATTGATCAAAATCACTCTTCCGGGGATGCCTTTTTCTGGCAATGCTTCTTCTTGGCATCCATGACGGGTCACGGC
CGTCGCTCCGGTGCTTTGGCATACCTGAATCGCTGTCTCCCCGTCCTGGCCCCCGTCCCGTCCAGCGGCCCTCCC
GTTGCCACCTCTGGAGACGAAGAGGACGACAGCTCCAAGATGGCGCTCGTCGTGACCTCTCCCGAGCCAGGGCTC
TTGGTACGCTGCTTTTCCAGTGGTCTGGCGGATCCGCAGCTGCTCATTCAACGCGGCTTCCTCGACCTCTTGGTA
TCCCATTTACCCCTGAACTCGAGTGTGCTGCGGTCCCGTGTGAAGCCTGTCGACCTCAAGCTGCTTGTCGAGGCC
GCCGCCGGAGTCGTGACGCGGCGGGACATGAGCTTGAACAGGCGGTTGTGGGCATGGCTTCTCGGTCCCGAGCCG
GCCGGCAACGAAGGCGAGAGTGCCGGCGATCCGACGACGCCGTCCCGTGAGCAGCAGCAGCAGCAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGTCGTTCCTCTCGCCCAAGACCAACTACTTTGAGGAGTTTGGGCTACAGCCGCTGACC
AAGGCCTTACTGGATATGATCAAGGGGGCTGCCAGCGGCACCGCTGCCGAACGAGCTCGACCGTACCGCATCTGT
CTCTCCCTGATGGACAAGTGGGAGATTGGGGGTCTCGTCGTTCCCCAGGTCTTTCTGCCCGTGGTGGAGAGCGTG
CAGCAGTATCAGAGCCGAGCGCCGGCAAAGGCTGATTTCGCCGAGGTCCTGCGCAGTGCCAGCGTCTTCTTCGAC
GGTATCGAGAGCGGTCTCATTTTTAGCGAGATGTTCCGGCTGCTGGCCCAGGCCTTGGGCGTCGAGAGCAGCAGC
ATGGACGAGCGGAGCGACAGAATCTCTCTAGTGGCCTTTATCGTGGCAAACTTCAACGTCCGTGAAGAAGACATG
GTAACAATCCACGGCCCTCTCACCTGTCTGGCTACCCTGTCGATGCTGGAGCACCTGCAGACCCGCACAGCCAAG
TCTGGCCTGGCGGCGTCCGAGATGGTCAAGCTCTCTGAGCAGGCTCTGAATGTGATCGTGTCGTTGGTGGAGCTG
GTGCCGGACCGCGCATTTCCAGCCAGCCGGAAAGAAGTCGCCTCCTCTCTGTCGATGGCCAAGTCGGATATACTG
AAGAAGCTCAGGACCTTCTATCTGGAGCTCCACGGTAACCTCGACTCGTCGCCGCCACCGTTTGAAGCGGTCGAA
TGCGGAGAGCTGCTGCTGAACAAGGCCGTCGAATACACGTACGATAATGGCGATGATGGCTCGGCACCATGCTCC
AACGAGGACCTGGGCTTACGCGTCCGCGTCTTTACGCTGATGCTGCTCAAGACGCCGACGAGCTACAGATTCGAC
GTTGAAAGGTCCATGTCGCACCTCAAGGCTCAGCTACAGCAGACGTGCCCGCTGCCCTTTTCCCATCTGTCGTCG
GTTCTGCACCTCGCCACGCAGCTCTACTCGGCCGAGAGGATCGACGCGAAGCAGCTCTCAGAGATGGTGGGCCCC
CTCGTCCGCCACGCGTGGTCTTACCTGGCATCGTCGGATCCGAAATACCACGTTGAGACGGTCCGTTGCCTGTGG
CAGCTTCAGACGGCCCTCACGCCGTGGAATCGCGAGATGGAAGCCGCTCTCTGCAGTATCCTGGTAGACGCCCCG
GTGTTTGCGGAAGCCGCACGCACCTTTGGCGTGCTCTGGTCGCATACGCTTCAGGACACGGCTGGCGACCGGCGA
GCGCCTCGGACGCCTATGCACGAGTATCGATCTACTCCCAGGCTTTCCGGCATGGAGCACTATCCGGTCATGCTG
ACGCAGCCCCTGTTCCTCGTCCTAGACGCCTTGCTGGACGAGCGGACGCAAGCCTACATGGTGGTCAAGTCGTGG
CTCAACAACACCATCGGGATAGACAGGTGAGGGGGCTTTTGATTTGTTTTTGATTTGTTTGTTTTTTCTGTTCTT
GGAGTAATCCTCCTTGTTGACTGTCTGCAGGCTCTTCCTTCTCTTCGTCACCAAGCTCTCCGAGCTGTCTTTTCT
GTCGGATGTCGGAAGCGAGAGCGGCAAGACAAACGGTGCCGACCCCATCATCTTCGGCCGAGACGATGACTTGGA
TCTCTGTCTGTACTATCTGCGGACTCTTCACTTCGTTCTCGCCTGTACCGGCGACGTTTCTCGCTCTGTATTGGC
GTCTAGATATCTCTCCTTTGGCGGCGGACAGACGCAAATACGTGGTATGTCTTTCATATTCCTGCTGTCCGAACA
AGTGGTGCTCACTCTCTTGCAATAGGTAGCGCCGAGGAGGGCGATATGACGCTGCAGGACTACTTCGTCCGCGTA
TGCGCTGAATGCGTCACGGGAGAGGTGACATCTGGCGCCGACCAGGACTTGACCGAGCAGGTCTCTCAGCTGCGT
CGATACGCGCTGATGATCCTTCATCAGTTCCTGTCGAGCCGCCATGCCGCATCTATCGCCCATCATCACCTCGAC
AAGGTCCTTTTGGACAGGCTTGCCAAGTCGATCAGTACGCCGGATCCATACGTCCAGGTGCTGCTGCTGGAAGTG
ATGCTCGACAGCCTCAAGCTGCAGGAGGCTTCGCAAGGGGAGCGACCACCGACGGCGACGTCGGAGAGGATGTCT
TCGATGACGGACCGAGCTCGGGCCGGCCGGACGTCGGGCTCCGTGAGCGACAGCTCCCCGGCCGGACCTCAGATG
CCTCCTCAGCTTCTCAAGTGTCTGCAGGCCGGTCTCAGCTGTCCCGGCAGCCACTCGGTGCTGGACAGCTGGATA
TCCTTCTTGGGGGACTGCCTTCCGTTCTTCGCCCACTCCATCTTCCAGATCCTGATTCCGCTCGTCGAGACGGTC
TGCAAACAGATAGGGCAGACGCTGTCGGATCTTCGCAACACGTTCCAGGCCGAGCCACGGCTGGCCGGCAGCAAG
GGCAGCGCGCCCGAGACGGCGCTCTTCTACCTGCTCAACGGGCTGGAGCGGGTGCTGGCTCTGGCGCACGATCAA
CTGCTGACGGAGGAGACGCGAGCGCGGCTGTTGAAGGGGCCCGAGCAGACGCAGTCTCTCCTGGGAAGCATGGTT
TCGGGCGTCTTTCAGTCGGAGAGCGCGCAGTCTCGGAGCGCTACGGCGAACGACCGGCTGACGGTGCACCTGGCC
TTCCAGGACACGATGAGGACGTGCTACGACATCTGGTCGTGGGGCCAGGGAGACGAGGCGAGGAAGCAGGACGTC
GGGTCGCTGGCGTCGTTCAACTACACGTCTCTTCGGATGAGGAACCGGGCCCGACGACTGCTGGAGCACCTGTTC
GCGGCCGAGACGCTCGAGTGTCTGGAGACGGTGATTGGCATCTGGCGGTCGGCGTCCGGGGAGGGCGAGCGGGCC
CAGGTCTTCAAGTTCCTGTCGGCCCTCGACGCCTGTCGGCCGAGGCACTGCGTCCCGGCGCTGTTCAACTCGATA
TACAGCCGGACGAACCCGGGCGCGCTGGACCCGTCTCGAAAGTCGGCCATGACGATTGCGCTGCAGGACCTGGAC
CTGGTGGTGTTTCTGGTCGAGTACGCGCGCTCGCTCGAAGACGACGCCATGGACGAGATCTGGGCCGACTGTATG
ACGTTTCTGCGAGACCTACTGGGCAACCCATTTCCTCACCGGCAGACGCTACCGAGCCTACTCGAGTTCGCCGGC
ATCCTGGGCGAGAAGGTGGACAATACCAACTTTGGAGAGCAGCGGAGGATGCGGCGCGAGCTGAGTGTCGGTTCA
TCATGCGAGTCTCGCTCGAGTTGGAGCAGGTCAACTGACGTCGACAGGATCTCTTCCTCCGCCTCCTGGCCGCCC
TCTTCACCACGCGGCCCATGACGTTTTCAGAGCCCAACGGAGCGGCGGACAAGTCCATGTCGTCATCCATCAACC
GGCGAAGGACACTGAGCAGCGGCGGCGACAGCGGCGACGACGTGGTACGGGTGCTGGCGTCCATCGTGCCCAAGC
TGCCGCAGATCCTGGTAGAGAACGACCGGGTGGCGTCGGCAGCAGCCACCATCTCAACCAACGTCATGGGCCCAG
CCCTGCGATCGCGAGCCTTCCCAGACACCTTCTCGCCCCGTCTACTGCGGCTGCTACTAGAGTTGTCACGGCTTC
AGGGCGGACACAAGGCATGGAAGAAGGACGTGAGCGAAGCCTTCAACGACGGCCGGTTCCTGGCCACGCGCGCCG
ACGTGGTTGAGGCGGAGTGGCTGCCGCTGCTCCGGCAATGGATGCTGGCGGATAAGGACCGAGTCACCGAGATGA
TGAGCCGGATCGGAGCCCCGACGACAGCCGGCATCGTCTTCGGCGTCGGCGCCACCTCGGCCCGGCTCGAAGCCG
ATCGCCGAACTCAACTCAACGTCCGACGAGCAGCGACTTTGGTCCTGGCAGCCGCCAACGACGGACTCGTCTCGG
AACTGCCTCTCGTGCTGGATAAGATGACGGAACTCCTGACGGCGACGCCCGTCTCGTCCCCCTCGTCAACCACCC
GAGCAGACATCTTCCAGCTCGTACGCGCCCTAGCCCTCAAGACAAGTCCCCTACACCTAGCCTCCCTCTGGCCCG
TCATCAACGCCGAAATGCAAGCCGTCCTCTCTTCCGTCGCCGACGCCGACGACGACTCCTACACCTCTGCCGCCG
TCGTCGAGGCCTGCAAGCTCCTCGATCTTCTCCTATGCGTCGCGCCCGATGACTTTCAGCTCCATGAATGGCTCT
TCGTCACGGATACCATTGACGCTCTTCACCGTCCATCTTCGTACCAACCCGTCGCGCTGGTGGATGATCTGGCCC
TCAACCTCTCAACCACGACCAAAACTACGAATCCAACTTTCACCACCACCACCATCACCACCACCACCATGATCA
AAAACACCCCGCAGGCAGCAAAAGACGACGACGACGACGACGACGACGACGACGGTCACCACCACCACCACCACC
ACCACCACCATCACCATCGCCGCCTCCCCTCCTCCTCTCCATCCCGTCAGCAGCAACAGAATCCCGCGCGGGGCT
GA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail