Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00183
Gene name
Locationscaffold_01:1108696..1109890
Strand-
Gene length (bp)1194
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12400 STIMATE STIMATE family 1.2E-40 155 282

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 62 84 22
3 97 119 22
4 157 179 22
5 217 239 22
6 254 276 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 29.25 14.48 44.03
Alive In ants, during behavior modification 57.95 31.89 84.02
Dead In ants, recently dead 57.72 31.90 83.53

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000454 yes
Alive Dead 0.987649 no
Dead Fungus 0.000454 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00183
MHPPSGEENAMASAPTSIMMMRTTTTTTTTTTAAAAMATALFATTTSSPMDAADSAQGECRLLGSFALLVQAALG
ALALLSLVYKRWRERPQRPLKIWFFDVSKQVFGSVLVHVANIFMSMLTSGRFDMIRPEPSAAATQRLKERADDGY
TPNPCSFYLLNLAIDTTVGIPILIILLRILTGLAAMTPLGKPSESIQSGNYGSPPNAWWWLKQSIIYFCGLFGMK
LCVLVIFVVLPWISVVGDWALGWTAGNERLQIAFVMMIFPLVMNALQYYIIDSFIKKKETVDREGLPQQEPDEMR
RHYDDETCRLRGPSTSEDEDEDEDDGDVHGENRDGGPASRRDYDPRFDGHAPTVIGIGPSQRASRIKLPTELYPK
E*
Coding >Ophcf2|00183
ATGCACCCTCCATCAGGCGAGGAGAACGCCATGGCCTCGGCGCCTACAAGTATCATGATGATGAGGACGACGACG
ACGACGACGACGACGACGACGGCGGCGGCTGCGATGGCAACGGCTCTCTTCGCCACGACGACTTCCTCCCCGATG
GACGCCGCCGACTCGGCCCAGGGCGAATGCAGGCTCCTCGGCTCCTTCGCGCTGCTCGTACAGGCTGCCCTCGGG
GCGCTGGCTTTGCTATCGCTCGTGTACAAGCGGTGGAGGGAAAGGCCGCAGCGGCCGCTCAAGATATGGTTCTTT
GACGTGTCGAAACAGGTGTTTGGGTCGGTGTTGGTGCACGTGGCCAATATCTTCATGTCCATGTTGACGAGTGGA
CGGTTTGATATGATCCGGCCTGAGCCTTCGGCTGCGGCTACGCAACGGTTGAAGGAGCGGGCTGACGATGGGTAC
ACGCCTAACCCGTGTTCGTTCTATCTTCTTAACCTGGCCATCGACACGACGGTCGGGATCCCCATCCTCATCATC
CTCCTCCGCATCCTCACCGGCCTCGCAGCCATGACCCCCCTCGGCAAACCCAGCGAATCAATCCAGTCAGGCAAC
TACGGTAGCCCCCCCAACGCCTGGTGGTGGCTCAAGCAATCCATCATATACTTTTGCGGCCTGTTCGGCATGAAG
CTCTGCGTCCTCGTCATCTTCGTCGTCCTCCCCTGGATCTCCGTCGTCGGCGACTGGGCTCTCGGCTGGACGGCC
GGAAACGAGAGGTTGCAGATTGCCTTCGTCATGATGATCTTTCCGCTCGTCATGAACGCGCTGCAGTACTACATC
ATCGATTCGTTTATTAAGAAGAAGGAGACGGTTGATAGGGAGGGGTTGCCGCAGCAGGAGCCGGATGAGATGCGG
CGACATTACGATGATGAGACGTGTCGTCTGCGAGGTCCCAGCACCAGCGAAGACGAAGACGAAGACGAAGACGAT
GGTGACGTCCACGGAGAGAATCGGGATGGAGGCCCAGCCAGTCGCCGAGATTACGACCCGCGCTTCGACGGCCAC
GCTCCCACCGTCATCGGCATCGGCCCCAGCCAAAGAGCAAGCCGAATCAAGCTCCCGACGGAGCTCTATCCGAAG
GAGTGA
Transcript >Ophcf2|00183
ATGCACCCTCCATCAGGCGAGGAGAACGCCATGGCCTCGGCGCCTACAAGTATCATGATGATGAGGACGACGACG
ACGACGACGACGACGACGACGGCGGCGGCTGCGATGGCAACGGCTCTCTTCGCCACGACGACTTCCTCCCCGATG
GACGCCGCCGACTCGGCCCAGGGCGAATGCAGGCTCCTCGGCTCCTTCGCGCTGCTCGTACAGGCTGCCCTCGGG
GCGCTGGCTTTGCTATCGCTCGTGTACAAGCGGTGGAGGGAAAGGCCGCAGCGGCCGCTCAAGATATGGTTCTTT
GACGTGTCGAAACAGGTGTTTGGGTCGGTGTTGGTGCACGTGGCCAATATCTTCATGTCCATGTTGACGAGTGGA
CGGTTTGATATGATCCGGCCTGAGCCTTCGGCTGCGGCTACGCAACGGTTGAAGGAGCGGGCTGACGATGGGTAC
ACGCCTAACCCGTGTTCGTTCTATCTTCTTAACCTGGCCATCGACACGACGGTCGGGATCCCCATCCTCATCATC
CTCCTCCGCATCCTCACCGGCCTCGCAGCCATGACCCCCCTCGGCAAACCCAGCGAATCAATCCAGTCAGGCAAC
TACGGTAGCCCCCCCAACGCCTGGTGGTGGCTCAAGCAATCCATCATATACTTTTGCGGCCTGTTCGGCATGAAG
CTCTGCGTCCTCGTCATCTTCGTCGTCCTCCCCTGGATCTCCGTCGTCGGCGACTGGGCTCTCGGCTGGACGGCC
GGAAACGAGAGGTTGCAGATTGCCTTCGTCATGATGATCTTTCCGCTCGTCATGAACGCGCTGCAGTACTACATC
ATCGATTCGTTTATTAAGAAGAAGGAGACGGTTGATAGGGAGGGGTTGCCGCAGCAGGAGCCGGATGAGATGCGG
CGACATTACGATGATGAGACGTGTCGTCTGCGAGGTCCCAGCACCAGCGAAGACGAAGACGAAGACGAAGACGAT
GGTGACGTCCACGGAGAGAATCGGGATGGAGGCCCAGCCAGTCGCCGAGATTACGACCCGCGCTTCGACGGCCAC
GCTCCCACCGTCATCGGCATCGGCCCCAGCCAAAGAGCAAGCCGAATCAAGCTCCCGACGGAGCTCTATCCGAAG
GAGTGA
Gene >Ophcf2|00183
ATGCACCCTCCATCAGGCGAGGAGAACGCCATGGCCTCGGCGCCTACAAGTATCATGATGATGAGGACGACGACG
ACGACGACGACGACGACGACGGCGGCGGCTGCGATGGCAACGGCTCTCTTCGCCACGACGACTTCCTCCCCGATG
GACGCCGCCGACTCGGCCCAGGGCGAATGCAGGCTCCTCGGCTCCTTCGCGCTGCTCGTACAGGCTGCCCTCGGG
GCGCTGGCTTTGCTATCGCTCGTGTACAAGCGGTGGAGGGAAAGGCCGCAGCGGCCGCTCAAGATATGGTTCTTT
GACGTGTCGAAACAGGTGTTTGGGTCGGTGTTGGTGCACGTGGCCAATATCTTCATGTCCATGTTGACGAGTGGA
CGGTTTGATATGATCCGGCCTGAGCCTTCGGCTGCGGCTACGCAACGGTTGAAGGAGCGGGCTGACGATGGGTAC
ACGCCTAACCCGTGTTCGTTCTATCTTCTTAACCTGGCCATCGACGTGAGTCTCTTTTTACTTGGCAATCCTGTA
ATCCTATCATCATGTCCTCTCTAACAAGAGCAGACGACGGTCGGGATCCCCATCCTCATCATCCTCCTCCGCATC
CTCACCGGCCTCGCAGCCATGACCCCCCTCGGCAAACCCAGCGAATCAATCCAGTCAGGCAACTACGGTAGCCCC
CCCAACGCCTGGTGGTGGCTCAAGCAATCCATCATATACTTTTGCGGCCTGTTCGGCATGAAGCTCTGCGTCCTC
GTCATCTTCGTCGTCCTCCCCTGGATCTCCGTCGTCGGCGACTGGGCTCTCGGCTGGACGGCCGGAAACGAGAGG
TTGCAGATTGCCTTCGTCATGATGATCTTTCCGCTCGTCATGAACGCGCTGCAGTACTACATCATCGATTCGTTT
ATTAAGAAGAAGGAGACGGTTGATAGGGAGGGGTTGCCGCAGCAGGAGCCGGATGAGATGCGGCGACATTACGAT
GATGAGACGTGTCGTCTGCGAGGTCCCAGCACCAGCGAAGACGAAGACGAAGACGAAGACGATGGTGACGTCCAC
GGAGAGAATCGGGATGGAGGCCCAGCCAGTCGCCGAGATTACGACCCGCGCTTCGACGGCCACGCTCCCACCGTC
ATCGGCATCGGCCCCAGCCAAAGAGCAAGCCGAATCAAGCTCCCGACGGAGCTCTATCCGAAGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail