Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00183
Gene name
Locationscaffold_01:1108696..1109890
Strand-
Gene length (bp)1194
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12400 STIMATE STIMATE family 1.2E-40 155 282

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 62 84 22
3 97 119 22
4 157 179 22
5 217 239 22
6 254 276 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00183
MHPPSGEENAMASAPTSIMMMRTTTTTTTTTTAAAAMATALFATTTSSPMDAADSAQGECRLLGSFALLVQAALG
ALALLSLVYKRWRERPQRPLKIWFFDVSKQVFGSVLVHVANIFMSMLTSGRFDMIRPEPSAAATQRLKERADDGY
TPNPCSFYLLNLAIDTTVGIPILIILLRILTGLAAMTPLGKPSESIQSGNYGSPPNAWWWLKQSIIYFCGLFGMK
LCVLVIFVVLPWISVVGDWALGWTAGNERLQIAFVMMIFPLVMNALQYYIIDSFIKKKETVDREGLPQQEPDEMR
RHYDDETCRLRGPSTSEDEDEDEDDGDVHGENRDGGPASRRDYDPRFDGHAPTVIGIGPSQRASRIKLPTELYPK
E*
Coding >Ophcf2|00183
ATGCACCCTCCATCAGGCGAGGAGAACGCCATGGCCTCGGCGCCTACAAGTATCATGATGATGAGGACGACGACG
ACGACGACGACGACGACGACGGCGGCGGCTGCGATGGCAACGGCTCTCTTCGCCACGACGACTTCCTCCCCGATG
GACGCCGCCGACTCGGCCCAGGGCGAATGCAGGCTCCTCGGCTCCTTCGCGCTGCTCGTACAGGCTGCCCTCGGG
GCGCTGGCTTTGCTATCGCTCGTGTACAAGCGGTGGAGGGAAAGGCCGCAGCGGCCGCTCAAGATATGGTTCTTT
GACGTGTCGAAACAGGTGTTTGGGTCGGTGTTGGTGCACGTGGCCAATATCTTCATGTCCATGTTGACGAGTGGA
CGGTTTGATATGATCCGGCCTGAGCCTTCGGCTGCGGCTACGCAACGGTTGAAGGAGCGGGCTGACGATGGGTAC
ACGCCTAACCCGTGTTCGTTCTATCTTCTTAACCTGGCCATCGACACGACGGTCGGGATCCCCATCCTCATCATC
CTCCTCCGCATCCTCACCGGCCTCGCAGCCATGACCCCCCTCGGCAAACCCAGCGAATCAATCCAGTCAGGCAAC
TACGGTAGCCCCCCCAACGCCTGGTGGTGGCTCAAGCAATCCATCATATACTTTTGCGGCCTGTTCGGCATGAAG
CTCTGCGTCCTCGTCATCTTCGTCGTCCTCCCCTGGATCTCCGTCGTCGGCGACTGGGCTCTCGGCTGGACGGCC
GGAAACGAGAGGTTGCAGATTGCCTTCGTCATGATGATCTTTCCGCTCGTCATGAACGCGCTGCAGTACTACATC
ATCGATTCGTTTATTAAGAAGAAGGAGACGGTTGATAGGGAGGGGTTGCCGCAGCAGGAGCCGGATGAGATGCGG
CGACATTACGATGATGAGACGTGTCGTCTGCGAGGTCCCAGCACCAGCGAAGACGAAGACGAAGACGAAGACGAT
GGTGACGTCCACGGAGAGAATCGGGATGGAGGCCCAGCCAGTCGCCGAGATTACGACCCGCGCTTCGACGGCCAC
GCTCCCACCGTCATCGGCATCGGCCCCAGCCAAAGAGCAAGCCGAATCAAGCTCCCGACGGAGCTCTATCCGAAG
GAGTGA
Transcript >Ophcf2|00183
ATGCACCCTCCATCAGGCGAGGAGAACGCCATGGCCTCGGCGCCTACAAGTATCATGATGATGAGGACGACGACG
ACGACGACGACGACGACGACGGCGGCGGCTGCGATGGCAACGGCTCTCTTCGCCACGACGACTTCCTCCCCGATG
GACGCCGCCGACTCGGCCCAGGGCGAATGCAGGCTCCTCGGCTCCTTCGCGCTGCTCGTACAGGCTGCCCTCGGG
GCGCTGGCTTTGCTATCGCTCGTGTACAAGCGGTGGAGGGAAAGGCCGCAGCGGCCGCTCAAGATATGGTTCTTT
GACGTGTCGAAACAGGTGTTTGGGTCGGTGTTGGTGCACGTGGCCAATATCTTCATGTCCATGTTGACGAGTGGA
CGGTTTGATATGATCCGGCCTGAGCCTTCGGCTGCGGCTACGCAACGGTTGAAGGAGCGGGCTGACGATGGGTAC
ACGCCTAACCCGTGTTCGTTCTATCTTCTTAACCTGGCCATCGACACGACGGTCGGGATCCCCATCCTCATCATC
CTCCTCCGCATCCTCACCGGCCTCGCAGCCATGACCCCCCTCGGCAAACCCAGCGAATCAATCCAGTCAGGCAAC
TACGGTAGCCCCCCCAACGCCTGGTGGTGGCTCAAGCAATCCATCATATACTTTTGCGGCCTGTTCGGCATGAAG
CTCTGCGTCCTCGTCATCTTCGTCGTCCTCCCCTGGATCTCCGTCGTCGGCGACTGGGCTCTCGGCTGGACGGCC
GGAAACGAGAGGTTGCAGATTGCCTTCGTCATGATGATCTTTCCGCTCGTCATGAACGCGCTGCAGTACTACATC
ATCGATTCGTTTATTAAGAAGAAGGAGACGGTTGATAGGGAGGGGTTGCCGCAGCAGGAGCCGGATGAGATGCGG
CGACATTACGATGATGAGACGTGTCGTCTGCGAGGTCCCAGCACCAGCGAAGACGAAGACGAAGACGAAGACGAT
GGTGACGTCCACGGAGAGAATCGGGATGGAGGCCCAGCCAGTCGCCGAGATTACGACCCGCGCTTCGACGGCCAC
GCTCCCACCGTCATCGGCATCGGCCCCAGCCAAAGAGCAAGCCGAATCAAGCTCCCGACGGAGCTCTATCCGAAG
GAGTGA
Gene >Ophcf2|00183
ATGCACCCTCCATCAGGCGAGGAGAACGCCATGGCCTCGGCGCCTACAAGTATCATGATGATGAGGACGACGACG
ACGACGACGACGACGACGACGGCGGCGGCTGCGATGGCAACGGCTCTCTTCGCCACGACGACTTCCTCCCCGATG
GACGCCGCCGACTCGGCCCAGGGCGAATGCAGGCTCCTCGGCTCCTTCGCGCTGCTCGTACAGGCTGCCCTCGGG
GCGCTGGCTTTGCTATCGCTCGTGTACAAGCGGTGGAGGGAAAGGCCGCAGCGGCCGCTCAAGATATGGTTCTTT
GACGTGTCGAAACAGGTGTTTGGGTCGGTGTTGGTGCACGTGGCCAATATCTTCATGTCCATGTTGACGAGTGGA
CGGTTTGATATGATCCGGCCTGAGCCTTCGGCTGCGGCTACGCAACGGTTGAAGGAGCGGGCTGACGATGGGTAC
ACGCCTAACCCGTGTTCGTTCTATCTTCTTAACCTGGCCATCGACGTGAGTCTCTTTTTACTTGGCAATCCTGTA
ATCCTATCATCATGTCCTCTCTAACAAGAGCAGACGACGGTCGGGATCCCCATCCTCATCATCCTCCTCCGCATC
CTCACCGGCCTCGCAGCCATGACCCCCCTCGGCAAACCCAGCGAATCAATCCAGTCAGGCAACTACGGTAGCCCC
CCCAACGCCTGGTGGTGGCTCAAGCAATCCATCATATACTTTTGCGGCCTGTTCGGCATGAAGCTCTGCGTCCTC
GTCATCTTCGTCGTCCTCCCCTGGATCTCCGTCGTCGGCGACTGGGCTCTCGGCTGGACGGCCGGAAACGAGAGG
TTGCAGATTGCCTTCGTCATGATGATCTTTCCGCTCGTCATGAACGCGCTGCAGTACTACATCATCGATTCGTTT
ATTAAGAAGAAGGAGACGGTTGATAGGGAGGGGTTGCCGCAGCAGGAGCCGGATGAGATGCGGCGACATTACGAT
GATGAGACGTGTCGTCTGCGAGGTCCCAGCACCAGCGAAGACGAAGACGAAGACGAAGACGATGGTGACGTCCAC
GGAGAGAATCGGGATGGAGGCCCAGCCAGTCGCCGAGATTACGACCCGCGCTTCGACGGCCACGCTCCCACCGTC
ATCGGCATCGGCCCCAGCCAAAGAGCAAGCCGAATCAAGCTCCCGACGGAGCTCTATCCGAAGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail