Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00178
Gene name
Locationscaffold_01:1095789..1099884
Strand+
Gene length (bp)4095
Transcript length (bp)3570
Coding sequence length (bp)3570
Protein length (aa) 1190

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 3.1E-80 153 361
PF02436 PYC_OADA Conserved carboxylase domain 2.9E-68 869 1068
PF00289 Biotin_carb_N Biotin carboxylase, N-terminal domain 8.1E-39 37 148
PF02785 Biotin_carb_C Biotin carboxylase C-terminal domain 2.6E-30 377 484
PF00682 HMGL-like HMGL-like 1.5E-25 576 844
PF00364 Biotin_lipoyl Biotin-requiring enzyme 7.3E-19 1120 1186
PF13533 Biotin_lipoyl_2 Biotin-lipoyl like 1.9E-05 1118 1151
PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus 5.3E-10 181 329
PF02222 ATP-grasp ATP-grasp domain 1.6E-07 176 331
PF02655 ATP-grasp_3 ATP-grasp domain 2.3E-05 191 332

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0008716 D-alanine-D-alanine ligase activity Yes
GO:0003824 catalytic activity Yes
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0016874 ligase activity No
GO:0016881 acid-amino acid ligase activity No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7136 0.4204 0.1092 0.0557 0.2392 0.095 0.1363 0.1659 0.1407 0.0341

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup275
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|605
Ophiocordyceps australis map64 (Brazil) OphauB2|278
Ophiocordyceps camponoti-floridani Ophcf2|00178 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06907
Ophiocordyceps camponoti-rufipedis Ophun1|109
Ophiocordyceps camponoti-rufipedis Ophun1|1375
Ophiocordyceps kimflemingae Ophio5|2035
Ophiocordyceps kimflemingae Ophio5|5075
Ophiocordyceps subramaniannii Hirsu2|364
Ophiocordyceps subramaniannii Hirsu2|9807

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00178
MSVPQQALTFNDVFDDDDIDEPKSVHHIRANSSIMQLKKILVANRGEIPIRIFRTAHELSLHTIAVYSYEDRLSM
HRQKADEAYVIGHRGQYTPVGAYLAGDEIIKIALEHGAQLIHPGYGFLSENAEFARNVEKAGLIFVGPSPEVIDS
LGDKVSARKLAIAAGVPVVPGTEGAVAKFDEVKSFTDKYGFPIIIKAAYGGGGRGMRVVRDAESLQENFERATSE
AKSAFGNGTVFVERFLDKPKHIEVQLLGDNQGNIVHLYERDCSVQRRHQKVVEIAPAKDLPTETRDAILADAVKL
AKSVNYRNAGTAEFLVDQQNRYYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGATLAQLGLTQDRISTRGFA
IQCRITTEDPAKQFQPDTGKIEVYRSAGGNGVRLDGGNGFAGAVITPFYDSMLVKCTCQGSTYEIARRKVLRALI
EFRVRGVKTNIPFLASLLTHPTFIDGNCWTTFIDDTPQLFDLVGGQNRAQKLLAYLGDVAVNGSAIKGQIGDPKF
KGDIILPTIYAPDGSKVDVSQPCQTGWRNILVEKGPKAFAKAVRQYKGCLLMDTTWRDAHQSLLATRVRTVDLLN
IAKETSHALSNLYSLECWGGATFDVAMRFLYEDPWDRLRQMRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVD
QAKKNGVDIFRVFDALNDIDQLEVGIKAVHKAGGVAEGTVCYSGDMLNPGKKYNLEYYMDLVDKLVKLDIHVLGI
KDMAGVLKPHAATLLIGSIRKKYPDLPIHVHTHDSAGTGVASMVACAKAGADAVDAATDSLSGMTSQPSINAILA
SLEGSDLDPGLDPRQVRALDTYWSQLRLLYSPFEAHLAGPDPEVYEHEIPGGQLTNMMFQASQLGLGSQWLETKK
AYEHANDLLGDIVKVTPTSKVVGDLAQFMVSNKLSAGDVKARASELDFPGSVLEFLEGLMGQPYGGFPEPLRSDA
LRGRRKLDKRPGLFLEPVDLVKAKKELLKKFGGPVTECDVASYVMYPKVFEDYKKFMQQYGDLSVLPTKYFLSRP
EIGEEFNVQLEKGKVLILKLLAVGPLSENTGQREVFFEMNGEVRQVTVVDKKAAVENVCRPKADPGDSSQVGAPM
SGVLVEMRVHEGSEVKKGDPLAVLSAMKMEMVISAPHSGKVASLQVKEGDSVDGSDLVCRITKA*
Coding >Ophcf2|00178
ATGTCGGTCCCTCAGCAAGCTCTCACCTTTAACGATGTCTTCGACGACGACGATATCGATGAGCCCAAGTCGGTG
CACCATATCCGCGCCAATTCGAGCATCATGCAACTCAAGAAAATTCTTGTTGCCAACCGTGGCGAAATCCCCATT
CGGATCTTCAGAACGGCCCATGAGCTATCGCTGCACACCATCGCCGTCTACAGTTACGAGGACCGTCTAAGCATG
CACCGCCAGAAGGCTGACGAGGCCTACGTCATTGGCCATCGCGGACAGTATACCCCTGTCGGAGCCTATCTCGCC
GGCGATGAGATTATCAAGATCGCCCTCGAGCACGGCGCTCAACTAATCCATCCTGGCTACGGCTTCTTATCCGAG
AACGCCGAGTTCGCTCGCAATGTGGAAAAGGCCGGTCTTATTTTCGTTGGTCCCTCTCCCGAAGTCATCGACTCC
CTCGGCGACAAGGTATCGGCCCGCAAGCTGGCCATCGCCGCCGGCGTCCCCGTCGTGCCCGGGACCGAAGGCGCC
GTAGCCAAGTTCGACGAGGTCAAGTCCTTTACGGACAAGTATGGCTTCCCCATCATCATCAAGGCAGCCTACGGT
GGTGGCGGTCGAGGCATGCGCGTCGTTCGTGATGCCGAAAGCCTGCAGGAAAACTTTGAGAGGGCCACGTCCGAG
GCCAAGTCGGCCTTTGGCAACGGCACCGTCTTCGTCGAGCGTTTCCTCGACAAGCCCAAGCACATCGAGGTCCAG
CTGCTGGGCGACAACCAGGGCAACATTGTTCACCTGTACGAGCGTGACTGCTCCGTTCAGCGCCGCCATCAAAAG
GTGGTGGAGATCGCTCCGGCCAAGGACCTTCCTACCGAGACGAGAGACGCCATCTTGGCCGACGCCGTAAAGCTG
GCCAAGTCGGTCAACTATCGCAACGCGGGTACGGCCGAGTTTCTGGTCGACCAGCAGAACCGATACTACTTCATC
GAGATCAACCCGCGTATCCAGGTCGAACATACCATCACCGAGGAGATTACGGGCATCGACATCGTCGCCGCTCAG
ATTCAGATCGCGGCTGGAGCGACGTTGGCGCAGCTCGGCCTGACGCAGGACCGCATCTCGACCCGCGGCTTCGCC
ATTCAGTGCCGCATCACCACCGAAGATCCGGCCAAGCAGTTCCAGCCCGACACTGGAAAGATTGAGGTCTACCGC
TCGGCTGGCGGCAACGGCGTCCGGCTGGACGGCGGGAACGGGTTCGCCGGCGCCGTAATCACGCCCTTTTACGAC
TCCATGTTGGTCAAGTGCACGTGTCAGGGCTCGACGTACGAGATTGCGCGCAGAAAGGTGCTCCGGGCCCTCATC
GAGTTCCGAGTCCGGGGCGTCAAGACCAACATCCCCTTCCTGGCCTCGCTCCTGACGCACCCGACTTTCATCGAT
GGCAACTGCTGGACGACGTTCATCGACGACACGCCCCAGCTATTCGACCTGGTCGGTGGCCAGAACCGAGCGCAG
AAGCTGCTGGCCTACCTGGGAGACGTGGCCGTCAACGGAAGCGCCATCAAGGGCCAGATAGGTGATCCCAAGTTC
AAGGGCGACATCATCCTCCCGACTATCTACGCGCCCGACGGCTCCAAGGTCGACGTCAGCCAGCCTTGCCAGACG
GGATGGCGCAACATCCTGGTCGAGAAGGGCCCCAAGGCCTTCGCCAAGGCTGTCCGTCAGTACAAGGGCTGCCTG
CTAATGGACACGACGTGGCGCGACGCCCATCAGTCGCTGCTGGCGACGCGCGTCCGGACCGTCGACCTGCTAAAC
ATCGCCAAGGAGACGAGCCACGCGCTGTCCAACCTGTACAGTCTCGAGTGCTGGGGCGGGGCCACGTTTGACGTG
GCCATGCGCTTCCTCTATGAGGATCCCTGGGATCGGCTCCGGCAGATGCGGAAGCTCGTGCCCAACATCCCCTTC
CAGATGCTCCTCCGAGGGGCCAACGGCGTCGCCTACTCGTCGCTGCCGGACAACGCCATCGATCACTTCGTCGAC
CAGGCCAAGAAGAATGGCGTCGACATCTTCCGCGTCTTCGACGCCCTCAACGATATCGACCAGCTCGAAGTGGGC
ATCAAGGCGGTTCACAAGGCCGGCGGCGTGGCCGAGGGCACCGTCTGCTACAGCGGCGACATGCTCAACCCGGGC
AAGAAGTACAACTTGGAGTATTACATGGACCTGGTCGACAAGCTCGTCAAGCTCGACATCCACGTGCTGGGCATC
AAGGACATGGCGGGCGTGCTAAAGCCACACGCGGCCACGCTGCTCATCGGATCCATCCGCAAGAAGTATCCGGAC
CTCCCGATCCACGTACACACGCACGACTCGGCCGGCACGGGCGTCGCGTCCATGGTGGCCTGCGCCAAGGCCGGG
GCCGACGCGGTCGACGCGGCGACGGACAGCCTGTCGGGAATGACGTCGCAGCCCAGCATCAACGCCATCCTCGCC
TCGCTGGAAGGCAGCGATCTCGACCCCGGCCTTGACCCGAGACAGGTTCGGGCCCTCGACACGTACTGGTCCCAG
CTACGGCTGCTGTACTCGCCCTTCGAGGCCCACCTCGCCGGACCGGACCCGGAGGTGTACGAGCACGAGATACCT
GGAGGGCAGCTGACCAACATGATGTTCCAAGCATCGCAGCTCGGCCTCGGCTCGCAATGGCTGGAGACGAAGAAG
GCGTACGAGCACGCCAACGACCTGCTCGGCGACATCGTCAAGGTGACGCCGACGTCCAAGGTGGTCGGTGACCTG
GCGCAGTTCATGGTGTCCAACAAGCTGTCGGCCGGAGACGTCAAGGCGCGGGCGTCGGAGCTCGACTTTCCCGGA
TCGGTGCTCGAGTTCCTCGAGGGCCTCATGGGCCAGCCATACGGGGGGTTTCCCGAGCCGCTCCGGTCCGACGCG
CTGCGAGGTCGGCGGAAGCTCGACAAGCGGCCCGGGCTGTTCCTGGAACCCGTGGACCTGGTCAAGGCCAAGAAG
GAGCTCCTCAAGAAGTTTGGCGGGCCGGTGACGGAGTGCGACGTGGCTTCGTACGTCATGTATCCCAAGGTGTTT
GAGGACTACAAGAAGTTCATGCAGCAGTACGGCGACCTGTCGGTGCTGCCGACCAAGTACTTCCTGTCGCGGCCG
GAGATTGGCGAGGAGTTCAACGTGCAGCTGGAGAAGGGCAAGGTGCTGATCCTGAAGCTTCTGGCGGTCGGCCCG
CTGAGCGAGAACACGGGCCAGCGCGAGGTGTTTTTCGAGATGAACGGCGAGGTGCGGCAGGTGACGGTGGTCGAC
AAGAAGGCGGCCGTCGAGAACGTTTGCCGTCCCAAGGCGGATCCGGGCGATTCGAGCCAGGTCGGGGCACCCATG
TCGGGCGTTCTGGTGGAGATGAGGGTTCACGAGGGCTCCGAGGTGAAGAAGGGAGATCCGCTGGCGGTGCTATCG
GCCATGAAGATGGAAATGGTCATCTCGGCTCCTCACAGCGGCAAAGTGGCGAGCCTCCAGGTCAAGGAGGGTGAC
TCGGTCGACGGGTCGGACCTGGTGTGCAGGATCACCAAGGCTTAA
Transcript >Ophcf2|00178
ATGTCGGTCCCTCAGCAAGCTCTCACCTTTAACGATGTCTTCGACGACGACGATATCGATGAGCCCAAGTCGGTG
CACCATATCCGCGCCAATTCGAGCATCATGCAACTCAAGAAAATTCTTGTTGCCAACCGTGGCGAAATCCCCATT
CGGATCTTCAGAACGGCCCATGAGCTATCGCTGCACACCATCGCCGTCTACAGTTACGAGGACCGTCTAAGCATG
CACCGCCAGAAGGCTGACGAGGCCTACGTCATTGGCCATCGCGGACAGTATACCCCTGTCGGAGCCTATCTCGCC
GGCGATGAGATTATCAAGATCGCCCTCGAGCACGGCGCTCAACTAATCCATCCTGGCTACGGCTTCTTATCCGAG
AACGCCGAGTTCGCTCGCAATGTGGAAAAGGCCGGTCTTATTTTCGTTGGTCCCTCTCCCGAAGTCATCGACTCC
CTCGGCGACAAGGTATCGGCCCGCAAGCTGGCCATCGCCGCCGGCGTCCCCGTCGTGCCCGGGACCGAAGGCGCC
GTAGCCAAGTTCGACGAGGTCAAGTCCTTTACGGACAAGTATGGCTTCCCCATCATCATCAAGGCAGCCTACGGT
GGTGGCGGTCGAGGCATGCGCGTCGTTCGTGATGCCGAAAGCCTGCAGGAAAACTTTGAGAGGGCCACGTCCGAG
GCCAAGTCGGCCTTTGGCAACGGCACCGTCTTCGTCGAGCGTTTCCTCGACAAGCCCAAGCACATCGAGGTCCAG
CTGCTGGGCGACAACCAGGGCAACATTGTTCACCTGTACGAGCGTGACTGCTCCGTTCAGCGCCGCCATCAAAAG
GTGGTGGAGATCGCTCCGGCCAAGGACCTTCCTACCGAGACGAGAGACGCCATCTTGGCCGACGCCGTAAAGCTG
GCCAAGTCGGTCAACTATCGCAACGCGGGTACGGCCGAGTTTCTGGTCGACCAGCAGAACCGATACTACTTCATC
GAGATCAACCCGCGTATCCAGGTCGAACATACCATCACCGAGGAGATTACGGGCATCGACATCGTCGCCGCTCAG
ATTCAGATCGCGGCTGGAGCGACGTTGGCGCAGCTCGGCCTGACGCAGGACCGCATCTCGACCCGCGGCTTCGCC
ATTCAGTGCCGCATCACCACCGAAGATCCGGCCAAGCAGTTCCAGCCCGACACTGGAAAGATTGAGGTCTACCGC
TCGGCTGGCGGCAACGGCGTCCGGCTGGACGGCGGGAACGGGTTCGCCGGCGCCGTAATCACGCCCTTTTACGAC
TCCATGTTGGTCAAGTGCACGTGTCAGGGCTCGACGTACGAGATTGCGCGCAGAAAGGTGCTCCGGGCCCTCATC
GAGTTCCGAGTCCGGGGCGTCAAGACCAACATCCCCTTCCTGGCCTCGCTCCTGACGCACCCGACTTTCATCGAT
GGCAACTGCTGGACGACGTTCATCGACGACACGCCCCAGCTATTCGACCTGGTCGGTGGCCAGAACCGAGCGCAG
AAGCTGCTGGCCTACCTGGGAGACGTGGCCGTCAACGGAAGCGCCATCAAGGGCCAGATAGGTGATCCCAAGTTC
AAGGGCGACATCATCCTCCCGACTATCTACGCGCCCGACGGCTCCAAGGTCGACGTCAGCCAGCCTTGCCAGACG
GGATGGCGCAACATCCTGGTCGAGAAGGGCCCCAAGGCCTTCGCCAAGGCTGTCCGTCAGTACAAGGGCTGCCTG
CTAATGGACACGACGTGGCGCGACGCCCATCAGTCGCTGCTGGCGACGCGCGTCCGGACCGTCGACCTGCTAAAC
ATCGCCAAGGAGACGAGCCACGCGCTGTCCAACCTGTACAGTCTCGAGTGCTGGGGCGGGGCCACGTTTGACGTG
GCCATGCGCTTCCTCTATGAGGATCCCTGGGATCGGCTCCGGCAGATGCGGAAGCTCGTGCCCAACATCCCCTTC
CAGATGCTCCTCCGAGGGGCCAACGGCGTCGCCTACTCGTCGCTGCCGGACAACGCCATCGATCACTTCGTCGAC
CAGGCCAAGAAGAATGGCGTCGACATCTTCCGCGTCTTCGACGCCCTCAACGATATCGACCAGCTCGAAGTGGGC
ATCAAGGCGGTTCACAAGGCCGGCGGCGTGGCCGAGGGCACCGTCTGCTACAGCGGCGACATGCTCAACCCGGGC
AAGAAGTACAACTTGGAGTATTACATGGACCTGGTCGACAAGCTCGTCAAGCTCGACATCCACGTGCTGGGCATC
AAGGACATGGCGGGCGTGCTAAAGCCACACGCGGCCACGCTGCTCATCGGATCCATCCGCAAGAAGTATCCGGAC
CTCCCGATCCACGTACACACGCACGACTCGGCCGGCACGGGCGTCGCGTCCATGGTGGCCTGCGCCAAGGCCGGG
GCCGACGCGGTCGACGCGGCGACGGACAGCCTGTCGGGAATGACGTCGCAGCCCAGCATCAACGCCATCCTCGCC
TCGCTGGAAGGCAGCGATCTCGACCCCGGCCTTGACCCGAGACAGGTTCGGGCCCTCGACACGTACTGGTCCCAG
CTACGGCTGCTGTACTCGCCCTTCGAGGCCCACCTCGCCGGACCGGACCCGGAGGTGTACGAGCACGAGATACCT
GGAGGGCAGCTGACCAACATGATGTTCCAAGCATCGCAGCTCGGCCTCGGCTCGCAATGGCTGGAGACGAAGAAG
GCGTACGAGCACGCCAACGACCTGCTCGGCGACATCGTCAAGGTGACGCCGACGTCCAAGGTGGTCGGTGACCTG
GCGCAGTTCATGGTGTCCAACAAGCTGTCGGCCGGAGACGTCAAGGCGCGGGCGTCGGAGCTCGACTTTCCCGGA
TCGGTGCTCGAGTTCCTCGAGGGCCTCATGGGCCAGCCATACGGGGGGTTTCCCGAGCCGCTCCGGTCCGACGCG
CTGCGAGGTCGGCGGAAGCTCGACAAGCGGCCCGGGCTGTTCCTGGAACCCGTGGACCTGGTCAAGGCCAAGAAG
GAGCTCCTCAAGAAGTTTGGCGGGCCGGTGACGGAGTGCGACGTGGCTTCGTACGTCATGTATCCCAAGGTGTTT
GAGGACTACAAGAAGTTCATGCAGCAGTACGGCGACCTGTCGGTGCTGCCGACCAAGTACTTCCTGTCGCGGCCG
GAGATTGGCGAGGAGTTCAACGTGCAGCTGGAGAAGGGCAAGGTGCTGATCCTGAAGCTTCTGGCGGTCGGCCCG
CTGAGCGAGAACACGGGCCAGCGCGAGGTGTTTTTCGAGATGAACGGCGAGGTGCGGCAGGTGACGGTGGTCGAC
AAGAAGGCGGCCGTCGAGAACGTTTGCCGTCCCAAGGCGGATCCGGGCGATTCGAGCCAGGTCGGGGCACCCATG
TCGGGCGTTCTGGTGGAGATGAGGGTTCACGAGGGCTCCGAGGTGAAGAAGGGAGATCCGCTGGCGGTGCTATCG
GCCATGAAGATGGAAATGGTCATCTCGGCTCCTCACAGCGGCAAAGTGGCGAGCCTCCAGGTCAAGGAGGGTGAC
TCGGTCGACGGGTCGGACCTGGTGTGCAGGATCACCAAGGCTTAA
Gene >Ophcf2|00178
ATGTCGGTCCCTCAGCAAGCTCTCACCTTTAACGATGTCTTCGACGACGACGATATCGATGAGCCCAAGTCGGTG
CACCATATCCGCGCCAATTCGAGCATCATGCAACTCAAGAAAATTCTTGGTGAGTTCAGTGATTGCCATTGTCCC
CCTATCGTTGAGCTGGCCTGACTGCTTCTCCCTTTCGCTTCAGTTGCCAACCGTGGCGAAATCCGTGAGTTTCTC
CTCCGCCTCTACCGTCCGATACCGTTGCTAACTCCTGCCAGCCATTCGGGTACGACTCACCACCACCAACACCCC
CCGCCCCCCTTTCCTCAAGATGCCGTGCTCACCGTCTCCGCCATCGTCAGATCTTCAGAACGGTACGTGACACCA
TGCGGCCTCTCAATAAAGCTTGTGCTTATAATAACCCCTCACAGGCCCATGAGCTATCGCTGCACACCATCGCCG
TCTACAGGTAACCTCGTCCGAACAAGGTGCGACGCGGTCCAATAGCTGACGTTGGACCAAGTTACGAGGACCGTC
TAAGCATGCACCGCCAGAGTCTGTCCTCCATTGCTAGATCCCCCGGTTACACAGCTGACCCTCCTTTATCTAGAG
GCTGACGAGGCCTACGTCATTGGCCATCGCGGACAGTATACCCCTGTCGGAGCCTATCTCGCCGGCGATGAGATT
ATCAAGATCGCCCTCGAGCACGGCGCTCAACTAATCCATCCTGGTAATTGGATCCAGAAATGCAACCTGCCTCGG
CTACTGACGGATTCCAGGCTACGGCTTCTTATCCGAGAACGCCGAGTTCGCTCGCAATGTGGAAAAGGCCGGTCT
TATTGTGAGTTCTAGCTAGACGTCGCGCACTTGGATGCGGGCTGACCCGACGCCAGTTCGTTGGTCCCTCTCCCG
AAGTCATCGACTCCCTCGGCGACAAGGTATCGGCCCGCAAGCTGGCCATCGCCGCCGGCGTCCCCGTCGTGCCCG
GGACCGAAGGCGCCGTAGCCAAGTTCGACGAGGTCAAGTCCTTTACGGACAAGTATGGCTTCCCCATCATCATCA
AGGCAGCCTACGGTGGTGGCGGTCGAGGCATGCGCGTCGTTCGTGATGCCGAAAGCCTGCAGGAAAACTTTGAGA
GGGCCACGTCCGAGGCCAAGTCGGCCTTTGGCAACGGCACCGTCTTCGTCGAGCGTTTCCTCGACAAGCCCAAGC
ACATCGAGGTCCAGCTGCTGGGCGACAACCAGGGCAACATTGTTCACCTGTACGAGCGTGACTGCTCCGTTCAGC
GCCGCCATCAAAAGGTGGTGGAGATCGCTCCGGCCAAGGACCTTCCTACCGAGACGAGAGACGCCATCTTGGCCG
ACGCCGTAAAGCTGGCCAAGTCGGTCAACTATCGCAACGCGGGTACGGCCGAGTTTCTGGTCGACCAGCAGAACC
GATACTACTTCATCGAGATCAACCCGCGTATCCAGGTCGAACATACCATCACCGAGGAGATTACGGGCATCGACA
TCGTCGCCGCTCAGATTCAGATCGCGGCTGGAGCGACGTTGGCGCAGCTCGGCCTGACGCAGGACCGCATCTCGA
CCCGCGGCTTCGCCATTCAGTGCCGCATCACCACCGAAGATCCGGCCAAGCAGTTCCAGCCCGACACTGGAAAGA
TTGAGGTCTACCGCTCGGCTGGCGGCAACGGCGTCCGGCTGGACGGCGGGAACGGGTTCGCCGGCGCCGTAATCA
CGCCCTTTTACGACTCCATGTTGGTCAAGTGCACGTGTCAGGGCTCGACGTACGAGATTGCGCGCAGAAAGGTGC
TCCGGGCCCTCATCGAGTTCCGAGTCCGGGGCGTCAAGACCAACATCCCCTTCCTGGCCTCGCTCCTGACGCACC
CGACTTTCATCGATGGCAACTGCTGGACGACGTTCATCGACGACACGCCCCAGCTATTCGACCTGGTCGGTGGCC
AGAACCGAGCGCAGAAGCTGCTGGCCTACCTGGGAGACGTGGCCGTCAACGGAAGCGCCATCAAGGGCCAGATAG
GTGATCCCAAGTTCAAGGGCGACATCATCCTCCCGACTATCTACGCGCCCGACGGCTCCAAGGTCGACGTCAGCC
AGCCTTGCCAGACGGGATGGCGCAACATCCTGGTCGAGAAGGGCCCCAAGGCCTTCGCCAAGGCTGTCCGTCAGT
ACAAGGGCTGCCTGCTAATGGACACGACGTGGCGCGACGCCCATCAGTCGCTGCTGGCGACGCGCGTCCGGACCG
TCGACCTGCTAAACATCGCCAAGGAGACGAGCCACGCGCTGTCCAACCTGTACAGTCTCGAGTGCTGGGGCGGGG
CCACGTTTGACGTGGCCATGCGCTTCCTCTATGAGGATCCCTGGGATCGGCTCCGGCAGATGCGGAAGCTCGTGC
CCAACATCCCCTTCCAGATGCTCCTCCGAGGGGCCAACGGCGTCGCCTACTCGTCGCTGCCGGACAACGCCATCG
ATCACTTCGTCGACCAGGCCAAGAAGAATGGCGTCGACATCTTCCGCGTCTTCGACGCCCTCAACGATATCGACC
AGCTCGAAGTGGGCATCAAGGCGGTTCACAAGGCCGGCGGCGTGGCCGAGGGCACCGTCTGCTACAGCGGCGACA
TGCTCAACCCGGGCAAGAAGTACAACTTGGAGTATTACATGGACCTGGTCGACAAGCTCGTCAAGCTCGACATCC
ACGTGCTGGGCATCAAGGACATGGCGGGCGTGCTAAAGCCACACGCGGCCACGCTGCTCATCGGATCCATCCGCA
AGAAGTATCCGGACCTCCCGATCCACGTACACACGCACGACTCGGCCGGCACGGGCGTCGCGTCCATGGTGGCCT
GCGCCAAGGCCGGGGCCGACGCGGTCGACGCGGCGACGGACAGCCTGTCGGGAATGACGTCGCAGCCCAGCATCA
ACGCCATCCTCGCCTCGCTGGAAGGCAGCGATCTCGACCCCGGCCTTGACCCGAGACAGGTTCGGGCCCTCGACA
CGTACTGGTCCCAGCTACGGCTGCTGTACTCGCCCTTCGAGGCCCACCTCGCCGGACCGGACCCGGAGGTGTACG
AGCACGAGATACCTGGAGGGCAGCTGACCAACATGATGTTCCAAGCATCGCAGCTCGGCCTCGGCTCGCAATGGC
TGGAGACGAAGAAGGCGTACGAGCACGCCAACGACCTGCTCGGCGACATCGTCAAGGTGACGCCGACGTCCAAGG
TGGTCGGTGACCTGGCGCAGTTCATGGTGTCCAACAAGCTGTCGGCCGGAGACGTCAAGGCGCGGGCGTCGGAGC
TCGACTTTCCCGGATCGGTGCTCGAGTTCCTCGAGGGCCTCATGGGCCAGCCATACGGGGGGTTTCCCGAGCCGC
TCCGGTCCGACGCGCTGCGAGGTCGGCGGAAGCTCGACAAGCGGCCCGGGCTGTTCCTGGAACCCGTGGACCTGG
TCAAGGCCAAGAAGGAGCTCCTCAAGAAGTTTGGCGGGCCGGTGACGGAGTGCGACGTGGCTTCGTACGTCATGT
ATCCCAAGGTGTTTGAGGACTACAAGAAGTTCATGCAGCAGTACGGCGACCTGTCGGTGCTGCCGACCAAGTACT
TCCTGTCGCGGCCGGAGATTGGCGAGGAGTTCAACGTGCAGCTGGAGAAGGGCAAGGTGCTGATCCTGAAGCTTC
TGGCGGTCGGCCCGCTGAGCGAGAACACGGGCCAGCGCGAGGTGTTTTTCGAGATGAACGGCGAGGTGCGGCAGG
TGACGGTGGTCGACAAGAAGGCGGCCGTCGAGAACGTTTGCCGTCCCAAGGCGGATCCGGGCGATTCGAGCCAGG
TCGGGGCACCCATGTCGGGCGTTCTGGTGGAGATGAGGGTTCACGAGGGCTCCGAGGTGAAGAAGGGAGATCCGC
TGGCGGTGCTATCGGCCATGAAGATGGTGAGTGAGCAGAAAAAGAGGTGTCTGGTAGACGACTTTGCGTGGTTGC
TAACGGTCTCAGGAAATGGTCATCTCGGCTCCTCACAGCGGCAAAGTGGCGAGCCTCCAGGTCAAGGAGGGTGAC
TCGGTCGACGGGTCGGACCTGGTGTGCAGGATCACCAAGGCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail