Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00177
Gene name
Locationscaffold_01:1090954..1093700
Strand+
Gene length (bp)2746
Transcript length (bp)2181
Coding sequence length (bp)2181
Protein length (aa) 727

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00135 COesterase Carboxylesterase family 7.4E-66 36 538
PF03650 MPC Mitochondrial pyruvate carriers 1.0E-31 606 703
PF20434 BD-FAE BD-FAE 4.4E-09 143 246

GO

GO Term Description Terminal node
GO:0006850 mitochondrial pyruvate transmembrane transport Yes
GO:0005743 mitochondrial inner membrane Yes
GO:0005575 cellular_component No
GO:1990542 mitochondrial transmembrane transport No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0071702 organic substance transport No
GO:0019866 organelle inner membrane No
GO:0098656 anion transmembrane transport No
GO:0006848 pyruvate transport No
GO:0034220 ion transmembrane transport No
GO:0015711 organic anion transport No
GO:0031090 organelle membrane No
GO:0051179 localization No
GO:0046942 carboxylic acid transport No
GO:0006820 anion transport No
GO:1905039 carboxylic acid transmembrane transport No
GO:1901475 pyruvate transmembrane transport No
GO:0015718 monocarboxylic acid transport No
GO:0031966 mitochondrial membrane No
GO:0055085 transmembrane transport No
GO:0006811 ion transport No
GO:1903825 organic acid transmembrane transport No
GO:0008150 biological_process No
GO:0015849 organic acid transport No
GO:0016020 membrane No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1472 0.1022 0.706 0.0883 0.2073 0.0802 0.4089 0.1743 0.1774 0.0418

SignalP

SignalP signal predicted Location Score
Yes 1 - 23 0.999769

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 83.41 46.25 120.58
Alive In ants, during behavior modification 74.36 41.11 107.62
Dead In ants, recently dead 63.17 35.77 90.57

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.602315 no
Alive Dead 0.353267 no
Dead Fungus 0.151454 no

Orthologs

Orthofinder run ID4
Orthogroup805
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6027
Ophiocordyceps australis 1348a (Ghana) OphauG2|7707
Ophiocordyceps australis map64 (Brazil) OphauB2|1941
Ophiocordyceps australis map64 (Brazil) OphauB2|276
Ophiocordyceps australis map64 (Brazil) OphauB2|4675
Ophiocordyceps camponoti-floridani Ophcf2|00177 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4506
Ophiocordyceps subramaniannii Hirsu2|361

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00177
MFATIVYASLVLGLLGGIGPAQGKGPVVDLGYAIHQGTLNESGDFYAFNNIRFAEPAKRFRLPNAVKTLSRSVLN
NGSVGNICPQAYPQWLLKKTGLSRQSLDKLIEGGSRQDEDCLFLDVVVSRKVWENRVVDRSWSCLKTNAGAPILV
WIHGGGFVFGHKRQGEYDPAGLMKRSQEDGGQGIIYVAINYRLGLYGWLNAGPHEPVVPNLGLADQRIALTWIER
NIHFFGGDAKKMTLMGQSAGGGSIMSHITALGGSKAPFVRAIIQSPYLAPIIDSPATWARVLATASKVAGRRIRN
SGELGRLDAEMLKTINSEVVAESPTEGFTFGPSVDGGNYLPAPPDVLLRQRRFDPEPVLMLGHTSHEWLSLSLPE
GNSTAAMEKKLNGLLPGLAARTRNLIFDELYPPPGRNTLYEYRNQEERSLLLRSELFISCNTRHISTSFVNKTFN
YRFQVPPGSHGQDVAYTFFNGGAKGIIGSLALDMQRYFLNFAEFGNPNGRGSVPKWPVYGENAKLATFGTEGVGF
DTDETRNRRCEYWQKGHFRADRVPSTSDDLDHVTRTNGSVKIRARKFPNQLRPRCQFAHRETHGSKMAAFFKAAN
AKIRSHPLLSYVCSTHFWGPVSNFGIPVAAVLDTQKSPELISGSMTGALCIYSLTFMRYSLAVTPRNYLLFLCHF
VNEGAQLTQGYRYLSYHNWGGKEKLELEKGMDAVKEKAERVSDTVKSAVGK*
Coding >Ophcf2|00177
ATGTTCGCTACCATCGTCTACGCCTCTCTTGTGCTGGGACTCCTGGGAGGCATCGGACCCGCTCAGGGAAAGGGT
CCGGTAGTGGACTTGGGATACGCTATTCACCAGGGCACGCTGAATGAAAGCGGCGATTTCTACGCCTTCAACAAC
ATCCGCTTCGCCGAGCCTGCGAAACGCTTCCGGCTGCCGAATGCCGTCAAGACGCTCAGCCGGTCCGTCCTCAAC
AATGGCTCCGTCGGTAACATCTGTCCCCAGGCCTATCCGCAATGGCTGCTGAAGAAGACGGGCCTGAGCCGGCAA
TCGCTTGATAAGTTGATAGAAGGGGGTTCGCGTCAGGACGAGGACTGCTTGTTCCTCGACGTCGTGGTGTCGAGG
AAAGTATGGGAGAATCGCGTCGTTGATCGGTCATGGTCATGTCTGAAGACGAATGCGGGAGCACCTATCTTGGTC
TGGATACATGGCGGCGGCTTCGTCTTCGGCCACAAGAGACAGGGCGAGTATGATCCTGCAGGGTTGATGAAGCGC
TCTCAGGAGGATGGAGGCCAAGGAATCATCTACGTTGCCATCAACTACCGACTGGGCCTGTACGGCTGGCTCAAC
GCCGGTCCTCACGAGCCCGTCGTTCCCAACCTCGGTCTGGCTGATCAGCGGATAGCTCTGACATGGATTGAGAGA
AACATTCACTTCTTTGGCGGCGATGCAAAAAAGATGACTCTCATGGGTCAATCTGCGGGCGGCGGCAGCATCATG
AGCCACATCACGGCCCTCGGCGGCTCCAAGGCTCCCTTTGTTCGCGCCATTATCCAAAGCCCGTATCTGGCACCC
ATCATCGACAGTCCTGCTACCTGGGCGCGCGTTCTGGCGACGGCCAGCAAGGTGGCGGGACGCAGAATCCGGAAC
AGCGGCGAGCTCGGCAGGCTTGATGCCGAGATGCTCAAGACCATCAATAGCGAGGTGGTGGCAGAGTCTCCGACT
GAAGGCTTCACTTTTGGCCCAAGCGTGGACGGCGGTAATTACTTACCCGCACCTCCCGACGTCCTCTTGAGGCAA
CGAAGATTCGATCCGGAGCCGGTGCTGATGCTCGGTCATACCTCGCACGAATGGCTGTCACTGTCATTGCCCGAA
GGCAACAGCACGGCCGCGATGGAGAAGAAGCTCAACGGCCTGCTTCCGGGTCTCGCGGCACGGACGCGGAACTTG
ATATTTGACGAGCTGTATCCGCCGCCGGGACGGAACACGCTGTACGAATACAGGAATCAAGAGGAGCGTAGCTTG
CTGCTCAGGTCGGAGCTCTTCATCAGCTGCAACACGCGCCATATCAGCACATCCTTCGTGAACAAGACGTTCAAC
TACCGGTTCCAGGTGCCGCCCGGATCCCATGGCCAGGACGTTGCCTACACCTTCTTCAACGGAGGGGCCAAGGGG
ATCATCGGTTCGCTGGCACTGGATATGCAGCGATATTTCCTCAACTTCGCAGAGTTTGGCAACCCCAACGGCAGG
GGCTCGGTGCCAAAGTGGCCTGTGTATGGCGAGAACGCGAAGCTGGCGACGTTTGGAACCGAGGGAGTCGGTTTT
GACACGGATGAGACGCGGAACAGGCGTTGCGAGTACTGGCAGAAGGGGCATTTTAGGGCGGATAGAGTTCCCTCG
ACGTCAGATGATCTTGACCACGTGACGCGGACGAATGGCTCCGTCAAAATCCGGGCGCGCAAATTCCCCAACCAA
CTTCGTCCCCGTTGCCAATTTGCACATCGCGAGACGCACGGCTCCAAGATGGCGGCTTTCTTCAAGGCAGCCAAT
GCCAAAATCCGATCACATCCGCTGCTGAGCTACGTCTGCTCAACCCACTTCTGGGGCCCCGTGTCCAACTTTGGC
ATCCCCGTTGCTGCCGTGCTCGATACGCAGAAGAGTCCTGAGCTCATCTCCGGATCGATGACGGGGGCGCTGTGC
ATCTACTCGTTGACGTTTATGCGATATTCTCTCGCCGTCACGCCGAGGAACTACCTTCTCTTCCTATGCCACTTC
GTCAACGAGGGCGCGCAGCTGACGCAAGGCTACCGATACCTGTCCTATCATAACTGGGGAGGCAAGGAGAAGCTG
GAGCTGGAGAAGGGCATGGACGCCGTCAAGGAAAAGGCCGAGAGGGTCTCAGATACGGTCAAGAGTGCTGTTGGG
AAATAG
Transcript >Ophcf2|00177
ATGTTCGCTACCATCGTCTACGCCTCTCTTGTGCTGGGACTCCTGGGAGGCATCGGACCCGCTCAGGGAAAGGGT
CCGGTAGTGGACTTGGGATACGCTATTCACCAGGGCACGCTGAATGAAAGCGGCGATTTCTACGCCTTCAACAAC
ATCCGCTTCGCCGAGCCTGCGAAACGCTTCCGGCTGCCGAATGCCGTCAAGACGCTCAGCCGGTCCGTCCTCAAC
AATGGCTCCGTCGGTAACATCTGTCCCCAGGCCTATCCGCAATGGCTGCTGAAGAAGACGGGCCTGAGCCGGCAA
TCGCTTGATAAGTTGATAGAAGGGGGTTCGCGTCAGGACGAGGACTGCTTGTTCCTCGACGTCGTGGTGTCGAGG
AAAGTATGGGAGAATCGCGTCGTTGATCGGTCATGGTCATGTCTGAAGACGAATGCGGGAGCACCTATCTTGGTC
TGGATACATGGCGGCGGCTTCGTCTTCGGCCACAAGAGACAGGGCGAGTATGATCCTGCAGGGTTGATGAAGCGC
TCTCAGGAGGATGGAGGCCAAGGAATCATCTACGTTGCCATCAACTACCGACTGGGCCTGTACGGCTGGCTCAAC
GCCGGTCCTCACGAGCCCGTCGTTCCCAACCTCGGTCTGGCTGATCAGCGGATAGCTCTGACATGGATTGAGAGA
AACATTCACTTCTTTGGCGGCGATGCAAAAAAGATGACTCTCATGGGTCAATCTGCGGGCGGCGGCAGCATCATG
AGCCACATCACGGCCCTCGGCGGCTCCAAGGCTCCCTTTGTTCGCGCCATTATCCAAAGCCCGTATCTGGCACCC
ATCATCGACAGTCCTGCTACCTGGGCGCGCGTTCTGGCGACGGCCAGCAAGGTGGCGGGACGCAGAATCCGGAAC
AGCGGCGAGCTCGGCAGGCTTGATGCCGAGATGCTCAAGACCATCAATAGCGAGGTGGTGGCAGAGTCTCCGACT
GAAGGCTTCACTTTTGGCCCAAGCGTGGACGGCGGTAATTACTTACCCGCACCTCCCGACGTCCTCTTGAGGCAA
CGAAGATTCGATCCGGAGCCGGTGCTGATGCTCGGTCATACCTCGCACGAATGGCTGTCACTGTCATTGCCCGAA
GGCAACAGCACGGCCGCGATGGAGAAGAAGCTCAACGGCCTGCTTCCGGGTCTCGCGGCACGGACGCGGAACTTG
ATATTTGACGAGCTGTATCCGCCGCCGGGACGGAACACGCTGTACGAATACAGGAATCAAGAGGAGCGTAGCTTG
CTGCTCAGGTCGGAGCTCTTCATCAGCTGCAACACGCGCCATATCAGCACATCCTTCGTGAACAAGACGTTCAAC
TACCGGTTCCAGGTGCCGCCCGGATCCCATGGCCAGGACGTTGCCTACACCTTCTTCAACGGAGGGGCCAAGGGG
ATCATCGGTTCGCTGGCACTGGATATGCAGCGATATTTCCTCAACTTCGCAGAGTTTGGCAACCCCAACGGCAGG
GGCTCGGTGCCAAAGTGGCCTGTGTATGGCGAGAACGCGAAGCTGGCGACGTTTGGAACCGAGGGAGTCGGTTTT
GACACGGATGAGACGCGGAACAGGCGTTGCGAGTACTGGCAGAAGGGGCATTTTAGGGCGGATAGAGTTCCCTCG
ACGTCAGATGATCTTGACCACGTGACGCGGACGAATGGCTCCGTCAAAATCCGGGCGCGCAAATTCCCCAACCAA
CTTCGTCCCCGTTGCCAATTTGCACATCGCGAGACGCACGGCTCCAAGATGGCGGCTTTCTTCAAGGCAGCCAAT
GCCAAAATCCGATCACATCCGCTGCTGAGCTACGTCTGCTCAACCCACTTCTGGGGCCCCGTGTCCAACTTTGGC
ATCCCCGTTGCTGCCGTGCTCGATACGCAGAAGAGTCCTGAGCTCATCTCCGGATCGATGACGGGGGCGCTGTGC
ATCTACTCGTTGACGTTTATGCGATATTCTCTCGCCGTCACGCCGAGGAACTACCTTCTCTTCCTATGCCACTTC
GTCAACGAGGGCGCGCAGCTGACGCAAGGCTACCGATACCTGTCCTATCATAACTGGGGAGGCAAGGAGAAGCTG
GAGCTGGAGAAGGGCATGGACGCCGTCAAGGAAAAGGCCGAGAGGGTCTCAGATACGGTCAAGAGTGCTGTTGGG
AAATAG
Gene >Ophcf2|00177
ATGTTCGCTACCATCGTCTACGCCTCTCTTGTGCTGGGACTCCTGGGAGGCATCGGACCCGCTCAGGGAAAGGGT
CCGGTAGTGGACTTGGGATACGCTATTCACCAGGGCACGCTGAATGTAGGCAGGACGCGACTCGACCACGGTCTG
ACTATTCCTGACGGTGTTCTCACAGGAAAGCGGCGATTTCTACGCCTTCAACAACATCCGCTTCGCCGAGCCTGC
GAAACGCTTCCGGCTGCCGAATGCCGTCAAGACGCTCAGCCGGTCCGTCCTCAACAATGGCTCCGTCGGTAACAT
CTGTCCCCAGGCCTATCCGCAATGGCTGCTGAAGAAGACGGGCCTGAGCCGGCAATCGCTTGATAAGTTGATAGA
AGGGGGTTCGCGTCAGGACGAGGACTGCTTGTTCCTCGACGTCGTGGTGTCGAGGAAAGTATGGGAGAATCGCGT
CGTTGATCGGTCATGGTCATGTCTGAAGACGAATGCGGGAGGTTTGTCTATTGCCCTTTCTCATGGCTAGCCGGT
TCCGACGGTGCAAGGACTGAGTACCCATCATTCTCAGCACCTATCTTGGTCTGGATACATGGCGGCGGCTTCGTC
TTCGGTAAGCATCTTCTCTGGTTGTACAGATCAAGGCAGAGATGGTGACGAAGCTTCAGGCCACAAGAGACAGGG
CGAGTATGATCCTGCAGGGTTGATGAAGCGCTCTCAGGAGGATGGAGGCCAAGGAATCATCTACGTTGCCATCAA
CTACCGACTGGGCCTGTACGGCTGGCTCAACGCCGGTCCTCACGAGCCCGTCGTTCCCAACCTCGGTCTGGCTGA
TCAGCGGATAGCTCTGACATGGTGAGCATTCGAGGAGGAGAAGACGAGGGTGCGGGATGCTGACAGACAATGGCA
AGGATTGAGAGAAACATTCACTTCTTTGGCGGCGATGCAAAAAAGATGACTCTCATGGGTCAATCTGCGGGCGGC
GGCAGCATCATGAGCCACATCACGGCCCTCGGCGGCTCCAAGGCTCCCTTTGTTCGCGCCATTATCCAAAGCCCG
TATCTGGCACCCATCATCGACAGTCCTGCTACCTGGGCGCGCGTTCTGGCGACGGCCAGCAAGGTGGCGGGACGC
AGAATCCGGAACAGCGGCGAGCTCGGCAGGCTTGATGCCGAGATGCTCAAGACCATCAATAGCGAGGTGGTGGCA
GAGTCTCCGACTGAAGGCTTCACTTTTGGCCCAAGCGTGGACGGCGGTAATTACTTACCCGCACCTCCCGACGTC
CTCTTGAGGCAACGAAGATTCGATCCGGAGCCGGTGCTGATGCTCGGTCATACCTCGCACGAATGGCTGTCACTG
TCATTGCCCGAAGGCAACAGCACGGCCGCGATGGAGAAGAAGCTCAACGGCCTGCTTCCGGGTCTCGCGGCACGG
ACGCGGAACTTGATATTTGACGAGCTGTATCCGCCGCCGGGACGGAACACGCTGTACGAATACAGGAATCAAGAG
GAGCGTAGCTTGCTGCTCAGGTCGGAGCTCTTCATCAGCTGCAACACGCGCCATATCAGCACATCCTTCGTGAAC
AAGACGTTCAACTACCGGTTCCAGGTGCCGCCCGGATCCCATGGCCAGGACGTTGCCTACACCTTCTTCAACGGA
GGGGCCAAGGGGATCATCGGTTCGCTGGCACTGGATATGCAGCGATATTTCCTCAACTTCGCAGAGTTTGGCAAC
CCCAACGGCAGGGGCTCGGTGCCAAAGTGGCCTGTGTATGGCGAGAACGCGAAGCTGGCGACGTTTGGAACCGAG
GGAGTCGGTTTTGACACGGATGAGACGCGGAACAGGCGTTGCGAGTACTGGCAGAAGGGGCATTTTAGGGCGGAT
AGGTAGGCAGGTAGGTAGGTAAATGATTGATTGGCTCCTCTGCATCTCTCGTAGAACAGACATGCAACTGGCTGA
TCCGAGGGTCTGTATTCGTACCTATTTCGTGGGAATATTCGTATGTATACCTAGATTCTCTCGCAGGCTGGTCGC
CCAGAGTTCCCTCGACGTCAGATGATCTTGACCACGTGACGCGGACGAATGGCTCCGTCAAAATCCGGGCGCGCA
AATTCCCCAACCAACTTCGTCCCCGTTGCCAATTTGCACATCGCGAGACGCACGGCTCCAAGATGGCGGCTTTCT
TCAAGGCAGCCAATGCCAAAATCCGATCACATCCGCTGCTGAGCTACGTCTGCTCAACCCGTGCGTTGCTCCCTC
TCGACACGACGGCGAAGCTCAGGCTAACGGTAACGGGTCTGAGACGGCAGACTTCTGGGGCCCCGTGTCCAACTT
TGGCATCCCCGTTGCTGCCGTGCTCGATACGCAGAAGAGTCCTGAGCTGTGGGTTCTTTTTTTTTTTTTTTTTTT
TTTTGGGAGGAAGGGGGGACTCGTTCCTTGCTGTGTCGTTGCGGTGGTCCTTGCAGCATGTTCTGACTGTTCTGG
GCTTTGTAGCATCTCCGGATCGATGACGGGGGCGCTGTGCATCTACTCGTTGACGTTTATGCGATATTCTCTCGC
CGTCACGCCGAGGAACTACCTTCTCTTCCTATGCCACTTCGTCAACGAGGGCGCGCAGCTGACGCAAGGCTACCG
ATACCTGTCCTATCATAACTGGGGAGGCAAGGAGAAGCTGGAGCTGGAGAAGGGCATGGACGCCGTCAAGGAAAA
GGCCGAGAGGGTCTCAGATACGGTCAAGAGTGCTGTTGGGAAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail