Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00173
Gene name
Locationscaffold_01:1080610..1081948
Strand+
Gene length (bp)1338
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12146 Hydrolase_4 Serine aminopeptidase, S33 1.4E-10 108 242
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 5.7E-06 110 214

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2871 0.1117 0.1275 0.1805 0.9074 0.1561 0.5484 0.4932 0.2429 0.1957

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2470
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2000
Ophiocordyceps australis map64 (Brazil) OphauB2|273
Ophiocordyceps camponoti-floridani Ophcf2|00173 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4503
Ophiocordyceps kimflemingae Ophio5|2029
Ophiocordyceps subramaniannii Hirsu2|356

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00173
MSSSSSTSSSSASSFLEQATGLLSSAATYMRLPALASTGVAAALTSLLYFKQKALIYPSHMPPNSRTDLPRPSQF
GIRDFEELVIPTDDGQKLSAFYIRGPRHGKNSDITVLMFHGNAGNIGHRLPIARMIIDVVGCNVFMLEYRGYGTS
TGQPDESGLNIDAQTGLNYLRERAETRSHRLIVYGQSLGGAVGIRLVAKNQDHGDIAGLILENTFLSMRKLIPSV
IPPAKYLTLLCHQVWPSETLLPTIKKVPVLFLSGLQDEIVPPDHMRQLYEICNAPGKKWRPLPGGDHNSSVIEQG
YFEAIAEFIAEATDGPVEPKMRL*
Coding >Ophcf2|00173
ATGTCCAGCTCCAGCTCGACGTCGTCATCATCCGCCAGTAGCTTCCTGGAGCAGGCTACCGGCCTGCTGAGCTCC
GCCGCTACCTACATGCGTCTTCCTGCTCTGGCCTCCACCGGCGTTGCCGCTGCCCTCACCTCTCTACTCTACTTC
AAGCAAAAGGCCTTGATCTACCCGTCGCACATGCCCCCCAACTCTCGGACCGACCTCCCGCGGCCCTCTCAGTTT
GGTATTCGAGACTTTGAGGAGCTCGTCATCCCTACCGATGACGGTCAGAAGCTGTCAGCCTTTTACATTCGCGGC
CCACGTCATGGCAAGAATTCAGACATAACCGTCCTCATGTTTCACGGCAACGCTGGCAACATCGGTCACCGCCTG
CCCATCGCCCGCATGATCATCGACGTCGTCGGCTGTAACGTCTTCATGCTCGAGTACAGAGGCTATGGCACCTCG
ACAGGCCAGCCGGACGAGTCTGGCCTAAACATCGATGCCCAAACTGGGCTCAACTACCTCCGCGAGCGTGCCGAG
ACGCGCAGCCACCGCCTCATTGTATACGGCCAGAGCCTCGGCGGTGCCGTTGGCATCAGGCTCGTGGCCAAGAAC
CAAGACCATGGCGACATTGCCGGCTTGATACTCGAAAACACCTTCCTGTCTATGCGGAAGCTGATACCTTCTGTC
ATCCCCCCGGCCAAGTACCTGACACTGTTGTGTCACCAGGTCTGGCCGAGCGAGACACTGCTGCCGACCATCAAA
AAGGTGCCCGTGCTGTTCCTGAGCGGCTTGCAGGACGAGATAGTCCCGCCCGACCACATGCGTCAGCTGTACGAA
ATCTGCAATGCGCCCGGCAAGAAATGGAGGCCTCTGCCGGGTGGTGACCACAACTCGAGCGTCATCGAGCAGGGC
TACTTCGAAGCCATAGCCGAGTTCATCGCCGAAGCTACCGATGGCCCCGTCGAGCCCAAGATGCGATTATGA
Transcript >Ophcf2|00173
ATGTCCAGCTCCAGCTCGACGTCGTCATCATCCGCCAGTAGCTTCCTGGAGCAGGCTACCGGCCTGCTGAGCTCC
GCCGCTACCTACATGCGTCTTCCTGCTCTGGCCTCCACCGGCGTTGCCGCTGCCCTCACCTCTCTACTCTACTTC
AAGCAAAAGGCCTTGATCTACCCGTCGCACATGCCCCCCAACTCTCGGACCGACCTCCCGCGGCCCTCTCAGTTT
GGTATTCGAGACTTTGAGGAGCTCGTCATCCCTACCGATGACGGTCAGAAGCTGTCAGCCTTTTACATTCGCGGC
CCACGTCATGGCAAGAATTCAGACATAACCGTCCTCATGTTTCACGGCAACGCTGGCAACATCGGTCACCGCCTG
CCCATCGCCCGCATGATCATCGACGTCGTCGGCTGTAACGTCTTCATGCTCGAGTACAGAGGCTATGGCACCTCG
ACAGGCCAGCCGGACGAGTCTGGCCTAAACATCGATGCCCAAACTGGGCTCAACTACCTCCGCGAGCGTGCCGAG
ACGCGCAGCCACCGCCTCATTGTATACGGCCAGAGCCTCGGCGGTGCCGTTGGCATCAGGCTCGTGGCCAAGAAC
CAAGACCATGGCGACATTGCCGGCTTGATACTCGAAAACACCTTCCTGTCTATGCGGAAGCTGATACCTTCTGTC
ATCCCCCCGGCCAAGTACCTGACACTGTTGTGTCACCAGGTCTGGCCGAGCGAGACACTGCTGCCGACCATCAAA
AAGGTGCCCGTGCTGTTCCTGAGCGGCTTGCAGGACGAGATAGTCCCGCCCGACCACATGCGTCAGCTGTACGAA
ATCTGCAATGCGCCCGGCAAGAAATGGAGGCCTCTGCCGGGTGGTGACCACAACTCGAGCGTCATCGAGCAGGGC
TACTTCGAAGCCATAGCCGAGTTCATCGCCGAAGCTACCGATGGCCCCGTCGAGCCCAAGATGCGATTATGA
Gene >Ophcf2|00173
ATGTCCAGCTCCAGCTCGACGTCGTCATCATCCGCCAGTAGCTTCCTGGAGCAGGCTACCGGCCTGCTGAGCTCC
GCCGCTACCTACATGCGTCTTCCTGCTCTGGCCTCCACCGTGAGCTGCCCCCAAGCTCCTCAGCCCCCTCCCTTC
ATATCCCTCTCTCAGCAGCCTCCTACTGACTCCCGCTTTCAGGGCGTTGCCGCTGCCCTCACCTCTCTACTCTAC
TTCAAGCAAAAGTCTGTCTCACCTCGCACGACAAGCGTCCCGTGTGACCCCGAGCCCGTGGGACGCCAAAGCTCA
CATCGCAAACAGGGCCTTGATCTACCCGTCGCACATGCCCCCCAACTCTCGGACCGACCTCCCGCGGCCCTCTCA
GTTTGGTATTCGAGACTTTGAGGAGCTCGTCATCCCTACCGATGACGGTCAGAAGCTGTCAGCCTTTTACATTCG
CGGCCCACGTCATGGCAAGAATTCAGACATAACCGTCCTCATGTTTCACGGCAACGCTGGCAACATCGGTCACCG
CCTGCCCATCGCCCGCATGATCATCGACGTCGTCGGCTGTAACGTCTTCATGCTCGAGTACAGAGGCTATGGCAC
CTCGACAGGCCAGCCGGACGAGTCTGGCCTAAACATCGATGCCCAAACTGGGCTCAACTACCTCCGCGAGCGTGC
CGAGACGCGCAGCCACCGCCTCATTGTATACGGCCAGAGCCTCGGCGGTGCCGTTGGCATCAGGCTCGTGGCCAA
GAACCAAGACCATGGCGACATTGCCGGCTTGATACTCGAAAACACCTTCCTGTCTATGCGGAAGCTGATACCTTC
TGTCATCCCCCCGGCCAAGTACCTGACACTGTTGTGTCACCAGGTCTGGCCGAGCGAGACACTGCTGCCGACCAT
CAAAAAGGTGCCCGTGCTGTTCCTGAGCGGCTTGCAGGACGAGATAGTCCCGTGAGTCTTTGATGGGCCCCCTCT
TCCCGTGCACATCTCCCGAGCATCGCCTGATGAAGCAACTTCACCCACAAAATATGAAATGGCCTACTTACGGGT
TCTTTGATTTTACACCACATCATTGTGTCTGACGATTGACGACTCCAACTCTTTGGTCCTCCACTGCCCTTCGAT
GCTCGTGACGGAGCTGACTTGCCCCTCCTCCCCCGCAGGCCCGACCACATGCGTCAGCTGTACGAAATCTGCAAT
GCGCCCGGCAAGAAATGGAGGCCTCTGCCGGGTGGTGACCACAACTCGAGCGTCATCGAGCAGGGCTACTTCGAA
GCCATAGCCGAGTTCATCGCCGAAGCTACCGATGGCCCCGTCGAGCCCAAGATGCGATTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail