Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00171
Gene name
Locationscaffold_01:1074631..1075776
Strand+
Gene length (bp)1145
Transcript length (bp)1080
Coding sequence length (bp)1080
Protein length (aa) 360

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04757 Pex2_Pex12 Pex2 / Pex12 amino terminal region 1.1E-35 28 228
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 2.7E-11 299 337
PF13639 zf-RING_2 Ring finger domain 8.6E-11 299 338
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.9E-09 300 337
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 2.7E-09 297 340
PF14634 zf-RING_5 zinc-RING finger domain 9.5E-07 299 339
PF13445 zf-RING_UBOX RING-type zinc-finger 1.4E-06 300 335

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Peroxisome Peroxisomal targeting signal 0.0975 0.1786 0.0378 0.01 0.1646 0.1439 0.5155 0.3153 0.19 0.7124

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2874
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1659
Ophiocordyceps australis map64 (Brazil) OphauB2|271
Ophiocordyceps camponoti-floridani Ophcf2|00171 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5662
Ophiocordyceps kimflemingae Ophio5|2027
Ophiocordyceps subramaniannii Hirsu2|4768

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00171
MTAPTSSSSPFPFASAPDIVRAHQKDGYFTGQVANQLTDLWRRIAGARAAHARAPELHCLGALLYLGLTTLPGNR
TLGEEYCHVVQVEARAGRLPALEARAAYVVGAVVVPYLVARLMPRVRAGIRAALHRRRASLAESGDGKAFQARLI
DYLSRHVSGFTSTAPLQALTLAFFYFQGSYYELSKRLLNLRYLFTRSMPDTPDRAGYEVLGVLLAIQLAVQSYLH
VRANLVSSPDSDPSPPLPETEPPSEPPPSTSPSTIQTPTQPPTAATNTPVAPDPRFDLADASVMAYIRGAQQRRC
TLCLDPLRDPSATQCGHVFCWRCIADWVREKPECPLCRREALVQHILPLRALHSVKATS*
Coding >Ophcf2|00171
ATGACGGCCCCGACCTCATCATCCTCGCCCTTCCCCTTCGCCTCAGCCCCAGACATCGTCCGCGCCCATCAAAAA
GACGGCTACTTCACCGGCCAGGTAGCCAACCAGCTAACCGACCTGTGGCGAAGGATAGCCGGAGCGCGCGCCGCC
CACGCCCGAGCCCCGGAGCTGCACTGCCTCGGCGCTCTGCTCTACCTCGGCTTGACGACGTTGCCGGGCAATCGG
ACGCTGGGCGAGGAGTACTGCCATGTCGTGCAGGTCGAGGCCCGGGCCGGACGGTTACCGGCTCTCGAGGCCCGG
GCCGCATATGTTGTTGGCGCCGTCGTGGTGCCGTATCTGGTTGCGAGGCTGATGCCGAGGGTGAGGGCTGGGATA
CGCGCCGCGCTGCATCGTCGACGGGCTTCATTGGCGGAAAGCGGTGATGGCAAGGCTTTCCAGGCTCGTCTCATC
GATTATCTCTCCCGCCACGTCTCGGGCTTCACGTCGACGGCGCCGCTGCAGGCCCTCACGCTGGCTTTCTTCTAC
TTCCAAGGCTCCTACTACGAGCTCAGCAAGCGGCTCCTCAACCTCCGCTACCTCTTCACCCGCTCCATGCCTGAC
ACGCCCGATCGCGCCGGCTACGAAGTCCTCGGCGTCCTCCTCGCCATCCAGCTCGCCGTCCAGTCGTATCTCCAC
GTACGCGCCAACCTCGTCTCCTCCCCCGACTCCGACCCCTCTCCTCCCCTCCCCGAGACCGAGCCGCCTTCCGAG
CCGCCACCGTCGACGTCTCCCTCGACCATACAAACGCCTACGCAGCCGCCAACAGCCGCCACCAACACGCCCGTC
GCGCCCGACCCCCGCTTCGACCTCGCCGACGCCTCCGTCATGGCCTACATTCGCGGCGCCCAGCAGCGGAGGTGC
ACCCTCTGCCTGGACCCCCTCCGCGACCCGTCCGCCACCCAGTGCGGCCACGTCTTTTGCTGGCGCTGCATCGCC
GACTGGGTCAGGGAGAAGCCTGAGTGTCCGCTGTGTCGGAGAGAGGCTCTGGTGCAGCACATACTCCCCCTGCGC
GCCTTGCATAGCGTAAAGGCAACCTCGTGA
Transcript >Ophcf2|00171
ATGACGGCCCCGACCTCATCATCCTCGCCCTTCCCCTTCGCCTCAGCCCCAGACATCGTCCGCGCCCATCAAAAA
GACGGCTACTTCACCGGCCAGGTAGCCAACCAGCTAACCGACCTGTGGCGAAGGATAGCCGGAGCGCGCGCCGCC
CACGCCCGAGCCCCGGAGCTGCACTGCCTCGGCGCTCTGCTCTACCTCGGCTTGACGACGTTGCCGGGCAATCGG
ACGCTGGGCGAGGAGTACTGCCATGTCGTGCAGGTCGAGGCCCGGGCCGGACGGTTACCGGCTCTCGAGGCCCGG
GCCGCATATGTTGTTGGCGCCGTCGTGGTGCCGTATCTGGTTGCGAGGCTGATGCCGAGGGTGAGGGCTGGGATA
CGCGCCGCGCTGCATCGTCGACGGGCTTCATTGGCGGAAAGCGGTGATGGCAAGGCTTTCCAGGCTCGTCTCATC
GATTATCTCTCCCGCCACGTCTCGGGCTTCACGTCGACGGCGCCGCTGCAGGCCCTCACGCTGGCTTTCTTCTAC
TTCCAAGGCTCCTACTACGAGCTCAGCAAGCGGCTCCTCAACCTCCGCTACCTCTTCACCCGCTCCATGCCTGAC
ACGCCCGATCGCGCCGGCTACGAAGTCCTCGGCGTCCTCCTCGCCATCCAGCTCGCCGTCCAGTCGTATCTCCAC
GTACGCGCCAACCTCGTCTCCTCCCCCGACTCCGACCCCTCTCCTCCCCTCCCCGAGACCGAGCCGCCTTCCGAG
CCGCCACCGTCGACGTCTCCCTCGACCATACAAACGCCTACGCAGCCGCCAACAGCCGCCACCAACACGCCCGTC
GCGCCCGACCCCCGCTTCGACCTCGCCGACGCCTCCGTCATGGCCTACATTCGCGGCGCCCAGCAGCGGAGGTGC
ACCCTCTGCCTGGACCCCCTCCGCGACCCGTCCGCCACCCAGTGCGGCCACGTCTTTTGCTGGCGCTGCATCGCC
GACTGGGTCAGGGAGAAGCCTGAGTGTCCGCTGTGTCGGAGAGAGGCTCTGGTGCAGCACATACTCCCCCTGCGC
GCCTTGCATAGCGTAAAGGCAACCTCGTGA
Gene >Ophcf2|00171
ATGACGGCCCCGACCTCATCATCCTCGCCCTTCCCCTTCGCCTCAGCCCCAGACATCGTCCGCGCCCATCAAAAA
GACGGCTACTTCACCGGCCAGGTAGCCAACCAGCTAACCGACCTGTGGCGAAGGATAGCCGGAGCGCGCGCCGCC
CACGCCCGAGCCCCGGAGCTGCACTGCCTCGGCGCTCTGCTCTACCTCGGCTTGACGACGTTGCCGGGCAATCGG
ACGCTGGGCGAGGAGTACTGCCATGTCGTGCAGGTCGAGGCCCGGGCCGGACGGTTACCGGCTCTCGAGGCCCGG
GCCGCATATGTTGTTGGCGCCGTCGTGGTGCCGTATCTGGTTGCGAGGCTGATGCCGAGGGTGAGGGCTGGGATA
CGCGCCGCGCTGCATCGTCGACGGGCTTCATTGGCGGAAAGCGGTGATGGCAAGGCTTTCCAGGCTCGTCTCATC
GATTATCTCTCCCGCCACGTCTCGGGCTTCACGTCGACGGCGCCGCTGCAGGCCCTCACGCTGGCTTTCTTCTAC
TTCCAAGGCTCCTACTACGAGCTCAGCAAGCGGCTCCTCAACCTCCGCTACCTCTTCACCCGCTCCATGCCTGAC
ACGCCCGATCGCGCCGGCTACGAAGTCCTCGGCGTCCTCCTCGCCATCCAGCTCGCCGTCCAGTCGTATCTCCAC
GTACGCGCCAACCTCGTCTCCTCCCCCGACTCCGACCCCTCTCCTCCCCTCCCCGAGACCGAGCCGCCTTCCGAG
CCGCCACCGTCGACGTCTCCCTCGACCATACAAACGCCTACGCAGCCGCCAACAGTGACCTCCTCCTCTCCGGAC
TCGGCGGCCCCCGCGGCCCCTCAACCAGCCGTATCGACCTCCAGGCCGCCACCAACACGCCCGTCGCGCCCGACC
CCCGCTTCGACCTCGCCGACGCCTCCGTCATGGCCTACATTCGCGGCGCCCAGCAGCGGAGGTGCACCCTCTGCC
TGGACCCCCTCCGCGACCCGTCCGCCACCCAGTGCGGCCACGTCTTTTGCTGGCGCTGCATCGCCGACTGGGTCA
GGGAGAAGCCTGAGTGTCCGCTGTGTCGGAGAGAGGCTCTGGTGCAGCACATACTCCCCCTGCGCGCCTTGCATA
GCGTAAAGGCAACCTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail