Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00156
Gene name
Locationscaffold_01:1040760..1042580
Strand+
Gene length (bp)1820
Transcript length (bp)1713
Coding sequence length (bp)1713
Protein length (aa) 571

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01798 Nop snoRNA binding domain, fibrillarin 5.1E-74 129 369
PF09785 Prp31_C Prp31 C terminal domain 7.9E-47 376 521

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3242 0.7146 0.0331 0.0361 0.1007 0.0026 0.0388 0.0125 0.0209 0.001

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2062
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|917
Ophiocordyceps australis map64 (Brazil) OphauB2|2594
Ophiocordyceps camponoti-floridani Ophcf2|00156 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7159
Ophiocordyceps kimflemingae Ophio5|633
Ophiocordyceps subramaniannii Hirsu2|2378

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00156
MSTIVDELLNDFGDSGDEQPEPHQGLANPEEDDDGADDAMDVDDDDDAHAAKDMHELEDAEATKARVEKMKLGAV
KDVRSVASLMQTLEPVLERIAQYRSQASVQTAAVGNIEDHPEYSLLTQSNSLSTMIDGEVALVHKFVRDHYSTRF
PELERLVTTPLEYAKVVSIIGNGPMTSDSITKLQTSTDNPLGMGLKAVLDGPSLMIVTVEATTSKGHNMSDEELQ
RVRRACDMVISLHKAKNMLVEYVQSRMTVFAPNLTALIGSLTAAQLLNAAGGLTGLSKTPACNIPSWGSKKRQAG
LATNVGIRQQGYLYHSDMMQHIPNDLKKQAMRIVAAKLVLAARVDRIHSSTDGRTGDELRSACLERLEKLTEPPP
NKGRRALPIPDDKPSRKRGGRRARKAKEALAMTELRKAQNRMAFGKEEKEVGYGTGEATVGLGMIGQQNDGRIRA
LQVDGRTRAKLSAKNKGWGGATNTGAASTMGQPGGIDLRAKGLRTTGVGSTIGTTSSLTFTPVQGLELVDPKVQA
ELGRKRKADEDRWFKGGSFTQIDDGFKVPDLPAAKRLDTGSTKRK*
Coding >Ophcf2|00156
ATGTCGACCATCGTCGACGAACTCCTCAACGACTTTGGGGACTCGGGCGATGAACAACCGGAGCCGCATCAAGGC
CTCGCCAACCCGGAAGAAGACGATGACGGCGCCGACGATGCCATGGACGTCGACGATGACGATGACGCACACGCC
GCCAAGGATATGCACGAGCTGGAAGATGCAGAGGCCACAAAGGCCAGGGTCGAGAAGATGAAGCTGGGCGCCGTC
AAGGATGTCCGCAGCGTCGCCAGCCTAATGCAAACGCTGGAGCCCGTTCTCGAGAGAATCGCCCAATATCGTTCG
CAGGCTTCGGTGCAGACCGCTGCCGTGGGCAACATCGAAGACCACCCCGAGTACAGCCTCTTGACTCAGTCAAAC
AGCCTGTCAACCATGATCGACGGTGAGGTGGCTCTCGTCCACAAGTTCGTACGCGATCACTACTCGACTCGCTTC
CCCGAACTCGAAAGGCTGGTGACGACGCCCCTGGAATACGCAAAGGTCGTGTCAATCATCGGTAACGGGCCGATG
ACGTCGGACAGCATCACGAAGCTGCAGACTTCGACGGACAATCCGCTCGGCATGGGGCTCAAGGCCGTCCTCGAC
GGACCGTCGCTCATGATCGTCACGGTCGAGGCCACGACGTCAAAGGGCCACAACATGAGCGATGAGGAGCTCCAG
CGCGTACGACGGGCCTGTGACATGGTCATCTCCCTGCACAAGGCCAAGAACATGCTGGTGGAATACGTGCAATCG
CGCATGACCGTCTTTGCGCCTAACCTGACGGCCCTCATCGGGTCCCTGACGGCGGCCCAGTTACTCAACGCCGCC
GGTGGTCTGACGGGCCTCTCCAAGACGCCGGCCTGCAACATACCATCGTGGGGATCCAAGAAGCGGCAGGCCGGG
CTGGCGACAAACGTGGGCATCCGACAGCAGGGCTACCTCTATCACTCGGACATGATGCAACACATTCCCAACGAC
CTCAAGAAGCAGGCCATGCGCATCGTGGCAGCCAAGCTGGTGCTAGCCGCCCGCGTGGACCGCATACACTCCAGC
ACCGACGGTCGTACCGGAGACGAGCTGCGTTCGGCCTGTCTGGAGCGGCTGGAGAAGCTGACGGAGCCTCCGCCC
AACAAGGGTCGACGCGCGCTGCCCATCCCGGACGACAAGCCATCCCGCAAACGCGGAGGACGACGGGCGCGCAAG
GCCAAGGAGGCGCTGGCCATGACGGAGCTTCGAAAAGCCCAGAACCGCATGGCCTTTGGCAAGGAGGAGAAGGAG
GTGGGCTACGGCACGGGAGAGGCCACCGTCGGCCTCGGCATGATCGGCCAGCAAAACGACGGCCGAATTCGAGCC
CTACAAGTCGACGGCCGGACTCGAGCCAAGCTGAGCGCCAAGAACAAAGGCTGGGGCGGCGCGACCAACACCGGA
GCGGCCTCGACCATGGGCCAACCGGGCGGCATCGACCTCCGAGCCAAGGGCCTCCGAACGACGGGCGTAGGCAGC
ACCATCGGCACCACATCATCTCTGACCTTTACCCCCGTCCAAGGCCTCGAGCTGGTCGACCCCAAAGTCCAAGCC
GAGCTGGGTCGCAAGCGCAAGGCGGATGAGGACCGGTGGTTCAAGGGCGGTTCTTTCACTCAGATCGACGACGGC
TTCAAGGTTCCCGATTTGCCGGCCGCGAAGCGACTCGATACGGGCTCGACTAAGCGGAAGTAA
Transcript >Ophcf2|00156
ATGTCGACCATCGTCGACGAACTCCTCAACGACTTTGGGGACTCGGGCGATGAACAACCGGAGCCGCATCAAGGC
CTCGCCAACCCGGAAGAAGACGATGACGGCGCCGACGATGCCATGGACGTCGACGATGACGATGACGCACACGCC
GCCAAGGATATGCACGAGCTGGAAGATGCAGAGGCCACAAAGGCCAGGGTCGAGAAGATGAAGCTGGGCGCCGTC
AAGGATGTCCGCAGCGTCGCCAGCCTAATGCAAACGCTGGAGCCCGTTCTCGAGAGAATCGCCCAATATCGTTCG
CAGGCTTCGGTGCAGACCGCTGCCGTGGGCAACATCGAAGACCACCCCGAGTACAGCCTCTTGACTCAGTCAAAC
AGCCTGTCAACCATGATCGACGGTGAGGTGGCTCTCGTCCACAAGTTCGTACGCGATCACTACTCGACTCGCTTC
CCCGAACTCGAAAGGCTGGTGACGACGCCCCTGGAATACGCAAAGGTCGTGTCAATCATCGGTAACGGGCCGATG
ACGTCGGACAGCATCACGAAGCTGCAGACTTCGACGGACAATCCGCTCGGCATGGGGCTCAAGGCCGTCCTCGAC
GGACCGTCGCTCATGATCGTCACGGTCGAGGCCACGACGTCAAAGGGCCACAACATGAGCGATGAGGAGCTCCAG
CGCGTACGACGGGCCTGTGACATGGTCATCTCCCTGCACAAGGCCAAGAACATGCTGGTGGAATACGTGCAATCG
CGCATGACCGTCTTTGCGCCTAACCTGACGGCCCTCATCGGGTCCCTGACGGCGGCCCAGTTACTCAACGCCGCC
GGTGGTCTGACGGGCCTCTCCAAGACGCCGGCCTGCAACATACCATCGTGGGGATCCAAGAAGCGGCAGGCCGGG
CTGGCGACAAACGTGGGCATCCGACAGCAGGGCTACCTCTATCACTCGGACATGATGCAACACATTCCCAACGAC
CTCAAGAAGCAGGCCATGCGCATCGTGGCAGCCAAGCTGGTGCTAGCCGCCCGCGTGGACCGCATACACTCCAGC
ACCGACGGTCGTACCGGAGACGAGCTGCGTTCGGCCTGTCTGGAGCGGCTGGAGAAGCTGACGGAGCCTCCGCCC
AACAAGGGTCGACGCGCGCTGCCCATCCCGGACGACAAGCCATCCCGCAAACGCGGAGGACGACGGGCGCGCAAG
GCCAAGGAGGCGCTGGCCATGACGGAGCTTCGAAAAGCCCAGAACCGCATGGCCTTTGGCAAGGAGGAGAAGGAG
GTGGGCTACGGCACGGGAGAGGCCACCGTCGGCCTCGGCATGATCGGCCAGCAAAACGACGGCCGAATTCGAGCC
CTACAAGTCGACGGCCGGACTCGAGCCAAGCTGAGCGCCAAGAACAAAGGCTGGGGCGGCGCGACCAACACCGGA
GCGGCCTCGACCATGGGCCAACCGGGCGGCATCGACCTCCGAGCCAAGGGCCTCCGAACGACGGGCGTAGGCAGC
ACCATCGGCACCACATCATCTCTGACCTTTACCCCCGTCCAAGGCCTCGAGCTGGTCGACCCCAAAGTCCAAGCC
GAGCTGGGTCGCAAGCGCAAGGCGGATGAGGACCGGTGGTTCAAGGGCGGTTCTTTCACTCAGATCGACGACGGC
TTCAAGGTTCCCGATTTGCCGGCCGCGAAGCGACTCGATACGGGCTCGACTAAGCGGAAGTAA
Gene >Ophcf2|00156
ATGTCGACCATCGTCGACGAACTCCTCAACGACTTTGGGGACTCGGGCGATGAACAACCGGAGCCGCATCAAGGC
CTCGCCAACCCGGAAGAAGACGATGACGGCGCCGACGATGCCATGGACGTCGACGATGACGATGACGCACACGCC
GCCAAGGATATGCACGAGCTGGAAGATGCAGAGGCCACAAAGGCCAGGGTCGAGAAGATGAAGCTGGGCGCCGTC
AAGGATGTCCGCAGCGTCGCCAGCCTAATGCAAACGCTGGAGCCCGTTCTCGAGGTCAGTTCCTCCCGTGGTCTT
TTATTCAACCTTTTTTTTTTTTTTTTTTTTTTTTTTTTAACCCGTTCGAGGAGACCTGACTTGGATCGTCTCGGT
CTGAATATTAGAGAATCGCCCAATATCGTTCGCAGGCTTCGGTGCAGACCGCTGCCGTGGGCAACATCGAAGACC
ACCCCGAGTACAGCCTCTTGACTCAGTCAAACAGCCTGTCAACCATGATCGACGGTGAGGTGGCTCTCGTCCACA
AGTTCGTACGCGATCACTACTCGACTCGCTTCCCCGAACTCGAAAGGCTGGTGACGACGCCCCTGGAATACGCAA
AGGTCGTGTCAATCATCGGTAACGGGCCGATGACGTCGGACAGCATCACGAAGCTGCAGACTTCGACGGACAATC
CGCTCGGCATGGGGCTCAAGGCCGTCCTCGACGGACCGTCGCTCATGATCGTCACGGTCGAGGCCACGACGTCAA
AGGGCCACAACATGAGCGATGAGGAGCTCCAGCGCGTACGACGGGCCTGTGACATGGTCATCTCCCTGCACAAGG
CCAAGAACATGCTGGTGGAATACGTGCAATCGCGCATGACCGTCTTTGCGCCTAACCTGACGGCCCTCATCGGGT
CCCTGACGGCGGCCCAGTTACTCAACGCCGCCGGTGGTCTGACGGGCCTCTCCAAGACGCCGGCCTGCAACATAC
CATCGTGGGGATCCAAGAAGCGGCAGGCCGGGCTGGCGACAAACGTGGGCATCCGACAGCAGGGCTACCTCTATC
ACTCGGACATGATGCAACACATTCCCAACGACCTCAAGAAGCAGGCCATGCGCATCGTGGCAGCCAAGCTGGTGC
TAGCCGCCCGCGTGGACCGCATACACTCCAGCACCGACGGTCGTACCGGAGACGAGCTGCGTTCGGCCTGTCTGG
AGCGGCTGGAGAAGCTGACGGAGCCTCCGCCCAACAAGGGTCGACGCGCGCTGCCCATCCCGGACGACAAGCCAT
CCCGCAAACGCGGAGGACGACGGGCGCGCAAGGCCAAGGAGGCGCTGGCCATGACGGAGCTTCGAAAAGCCCAGA
ACCGCATGGCCTTTGGCAAGGAGGAGAAGGAGGTGGGCTACGGCACGGGAGAGGCCACCGTCGGCCTCGGCATGA
TCGGCCAGCAAAACGACGGCCGAATTCGAGCCCTACAAGTCGACGGCCGGACTCGAGCCAAGCTGAGCGCCAAGA
ACAAAGGCTGGGGCGGCGCGACCAACACCGGAGCGGCCTCGACCATGGGCCAACCGGGCGGCATCGACCTCCGAG
CCAAGGGCCTCCGAACGACGGGCGTAGGCAGCACCATCGGCACCACATCATCTCTGACCTTTACCCCCGTCCAAG
GCCTCGAGCTGGTCGACCCCAAAGTCCAAGCCGAGCTGGGTCGCAAGCGCAAGGCGGATGAGGACCGGTGGTTCA
AGGGCGGTTCTTTCACTCAGATCGACGACGGCTTCAAGGTTCCCGATTTGCCGGCCGCGAAGCGACTCGATACGG
GCTCGACTAAGCGGAAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail