Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00151
Gene name
Locationscaffold_01:1025033..1026610
Strand+
Gene length (bp)1577
Transcript length (bp)900
Coding sequence length (bp)900
Protein length (aa) 300

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04178 Got1 Got1/Sft2-like family 1.4E-34 165 276

GO

GO Term Description Terminal node
GO:0016192 vesicle-mediated transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 167 189 22
2 196 215 19
3 230 248 18
4 255 277 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00151
MWPPAPGSRIDFAPPPPPNLQPCAFPSTAFQICISSGPPSDPVISPLDFSTRRLSSSRSLAFSFVHLLVPVSCAR
RRKGSSSRSRLPSSFRDSINSLGWSRRGNDEPANTSQQSGLLSSIKNLSPFQDRGYMRLPTTESPGAPLPAPSRR
EEEEGWFVLSRWDRLLVFGACNLAALACFVICFTLFPVLSLRPRKFVILWSVGSILFLASFAAVMGPVNYLHHLF
STPRLPFTAAYFGSILLTLVFALKLHSTILTLLSAVAQLACLIWYLVSYFPMGSAGLRLAASFGTRQATAWMSG*
Coding >Ophcf2|00151
ATGTGGCCCCCCGCGCCCGGCTCACGTATCGATTTCGCTCCTCCACCCCCTCCAAATCTCCAGCCTTGCGCCTTT
CCCTCGACTGCCTTCCAAATCTGCATCTCGTCTGGCCCTCCTTCAGACCCCGTCATCAGCCCTCTCGACTTTTCG
ACTCGACGCTTGTCATCGTCTCGCTCGCTTGCCTTCTCATTCGTCCACCTGCTCGTGCCCGTGAGCTGCGCCAGA
CGAAGGAAGGGGTCGTCATCACGCAGTCGCTTGCCTAGCTCCTTTCGGGATTCCATAAACTCGCTCGGCTGGAGT
CGACGAGGCAACGATGAACCCGCCAATACGTCGCAGCAGTCCGGACTGCTCTCCTCTATCAAGAACCTGTCTCCC
TTTCAAGACCGTGGTTACATGCGCCTGCCGACCACTGAGAGTCCTGGAGCACCTCTACCGGCACCAAGTCGGCGA
GAGGAGGAAGAGGGCTGGTTCGTTTTGAGCAGATGGGACCGGTTGTTGGTCTTCGGGGCTTGCAACCTGGCCGCT
CTCGCCTGTTTCGTCATCTGCTTCACTCTTTTCCCGGTCCTGTCTCTCCGGCCGCGCAAGTTTGTCATTCTGTGG
TCTGTCGGCTCGATACTCTTCTTGGCGTCCTTTGCCGCTGTCATGGGCCCGGTCAACTACTTGCACCATCTCTTC
TCTACGCCCAGACTGCCATTTACTGCGGCGTACTTTGGTTCCATATTGTTGACCCTAGTATTTGCCCTCAAGCTT
CACAGCACCATCCTGACTCTTCTCTCTGCCGTGGCCCAGCTCGCGTGCCTAATTTGGTACCTCGTCAGCTACTTT
CCCATGGGCTCGGCGGGATTGCGTCTGGCGGCCTCGTTCGGAACGCGGCAAGCTACAGCGTGGATGTCGGGCTGA
Transcript >Ophcf2|00151
ATGTGGCCCCCCGCGCCCGGCTCACGTATCGATTTCGCTCCTCCACCCCCTCCAAATCTCCAGCCTTGCGCCTTT
CCCTCGACTGCCTTCCAAATCTGCATCTCGTCTGGCCCTCCTTCAGACCCCGTCATCAGCCCTCTCGACTTTTCG
ACTCGACGCTTGTCATCGTCTCGCTCGCTTGCCTTCTCATTCGTCCACCTGCTCGTGCCCGTGAGCTGCGCCAGA
CGAAGGAAGGGGTCGTCATCACGCAGTCGCTTGCCTAGCTCCTTTCGGGATTCCATAAACTCGCTCGGCTGGAGT
CGACGAGGCAACGATGAACCCGCCAATACGTCGCAGCAGTCCGGACTGCTCTCCTCTATCAAGAACCTGTCTCCC
TTTCAAGACCGTGGTTACATGCGCCTGCCGACCACTGAGAGTCCTGGAGCACCTCTACCGGCACCAAGTCGGCGA
GAGGAGGAAGAGGGCTGGTTCGTTTTGAGCAGATGGGACCGGTTGTTGGTCTTCGGGGCTTGCAACCTGGCCGCT
CTCGCCTGTTTCGTCATCTGCTTCACTCTTTTCCCGGTCCTGTCTCTCCGGCCGCGCAAGTTTGTCATTCTGTGG
TCTGTCGGCTCGATACTCTTCTTGGCGTCCTTTGCCGCTGTCATGGGCCCGGTCAACTACTTGCACCATCTCTTC
TCTACGCCCAGACTGCCATTTACTGCGGCGTACTTTGGTTCCATATTGTTGACCCTAGTATTTGCCCTCAAGCTT
CACAGCACCATCCTGACTCTTCTCTCTGCCGTGGCCCAGCTCGCGTGCCTAATTTGGTACCTCGTCAGCTACTTT
CCCATGGGCTCGGCGGGATTGCGTCTGGCGGCCTCGTTCGGAACGCGGCAAGCTACAGCGTGGATGTCGGGCTGA
Gene >Ophcf2|00151
ATGTGGCCCCCCGCGCCCGGCTCACGTATCGATTTCGCTCCTCCACCCCCTCCAAATCTCCAGCCTTGCGCCTTT
CCCTCGACTGCCTTCCAAATCTGCATCTCGTCTGGCCCTCCTTCAGACCCCGTCATCAGCCCTCTCGACTTTTCG
ACTCGACGCTTGTCATCGTCTCGCTCGCTTGCCTTCTCATTCGTCCACCTGCTCGTGCCCGTGAGCTGCGCCAGA
CGAAGGAAGGGGTCGTCATCGTAACGTCTCCCCCCCTCCACCCCCCTTTTGCTGGACCAAGGCAATCCCGTTTGG
ATCGCTTCAACCCGGCCTCCATCCTCTCCCCCCCCTCACCCCATCATTTTGTCGTCTGCCCGCCTCTCTGGCGTC
TTCTCTCTTTACCTGGGAGATCCGAGCACCTCGACTGACCCGTACCCAGACGCAGTCGCTTGCCTAGGTACCCGT
TAGGGCACCTCTCACTACGAGGCCGCGCGCATCATCCCCCCCCCTAAAGCCCCCCCTGACGCAAACCCCCCACCC
TCTCAACAAGTCGACTCCGAATCTCATCGCAAAAGAATTGTCGATCGCGCTCGCTGCCGTTCCCGCGTTTCCCGT
ATCCGCGTCGCCACCCATGGCGTCAAGCTCCTTTCGGGATTCCATAAACTCGCTCGGCTGGAGTCGACGAGGCAA
CGATGAACCCGCCAATACGTCGCAGCAGTCCGGACTGCTCTCCTCTATCAAGAACCTGTCTCCCTTTCAAGACCG
TGGTTACATGCGCCTGCCGACCACTGAGAGTCCTGGAGCACCTCTACCGGCACCAAGTCGGCGAGAGGAGGAAGA
GGGCTGGTTCGTTTGTGAGTCAACCTGACGACATGAGGTCGCGACCCCCCTGCACCGGGACATGCGCATGGCAAT
CTCTTGTCCATGAACCGGATTCTGCATGTGATACGCCCCATGGGCGGCAGAGCTAACTCGAGGTTGCAGTGAGCA
GATGGGACCGGTTGTTGGTCTTCGGGGCTTGCAACCTGGCCGCTCTCGCCTGTTTCGTCATCTGCTTCACTCTTT
TCCCGGTCCTGTCTCTCCGGCCGCGCAAGTTTGTCATTCTGTGAGTGAGAAAAGTCCATCTCGGTAGCATGCCGC
CTGACGTCTTTGGCGTCGTCTTCCCGCTCCCCCCCCCCCTTCCAGTGTCGCGTCCTAGATGTTGCCTATTCTCGA
CGTACGACTAACAGTGCGCAGGTGGTCTGTCGGCTCGATACTCTTCTTGGCGTCCTTTGCCGCTGTCATGGGCCC
GGTCAACTACTTGCACCATCTCTTCTCTACGCCCAGACTGCCATTTACTGCGGCGTACTTTGGTTCCATATTGTT
GACCCTAGTATTTGCCCTCAAGGTATGTCGTCGGATTCTTCCCGTTCAAAGTCAGGCCTAACGCTTTTGTGCAGC
TTCACAGCACCATCCTGACTCTTCTCTCTGCCGTGGCCCAGCTCGCGTGCCTAATTTGGTACCTCGTCAGCTACT
TTCCCATGGGCTCGGCGGGATTGCGTCTGGCGGCCTCGTTCGGAACGCGGCAAGCTACAGCGTGGATGTCGGGCT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail