Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00149
Gene name
Locationscaffold_01:1020523..1022158
Strand-
Gene length (bp)1635
Transcript length (bp)1635
Coding sequence length (bp)1635
Protein length (aa) 545

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00010 HLH Helix-loop-helix DNA-binding domain 4.1E-11 300 403

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0005515 protein binding No
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.5301 0.892 0.0143 0.0322 0.1947 0.0002 0.0663 0.3033 0.0475 0.003

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2683
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7403
Ophiocordyceps australis map64 (Brazil) OphauB2|3498
Ophiocordyceps camponoti-floridani Ophcf2|00149 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5350
Ophiocordyceps kimflemingae Ophio5|6771
Ophiocordyceps subramaniannii Hirsu2|4182

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00149
MAQHGFNHFGSAPNGGNIDPNDLSMAGDYSPPFNNGGSSAGNNNNNNNGTGSAPNGYSSGSAVFGDDELLDGLAS
PSDGHSAMHAHGQDYAAISVGFPQGPFASHRGSGMHIDPSQMNGAFSNTPDGDPIHSPYGASFSTHFRQMPNSHS
FGTSLHSPMSYSGSPLAGGDINADGHEPAYLKARARMSQQMQRKASNTRSPMTPKNNSIHGIPIGSHDSPGYGPQ
PVRNSGSHDKSPSAQWMNTPAGSIPASYNSGFSSPMQQGMVPINEVMLKGGTSMPAKLGVASGAVSTQEMKRKRR
RESHNLVERRRRDNINERIQDLSKLVPTHRLEDEKIRKLLSNGTPLSPTLTGMSNPSQATSGLAGPGARRAAGGS
AGNITTGLPMEEKDKGPNKGDILNGAVSWARDLMWMLHLKLQQQEELMNTIAELGGHFPFELTEDERRMQTELMD
AMAKSGTGSFSYSRTSGSGLRVPSHTDYRGDPVNGLTPNLDSIGITPEDNGNAGLGGDLGDAAAQFWHDPDDDGS
GNASLQFKEEDEYDMDLTQ*
Coding >Ophcf2|00149
ATGGCCCAACACGGCTTCAACCACTTCGGCTCCGCGCCCAACGGCGGAAACATCGATCCCAACGATCTCTCTATG
GCCGGTGACTACTCTCCGCCCTTCAACAATGGCGGAAGCAGCGCCGGTAACAATAACAATAACAACAACGGCACC
GGAAGCGCTCCTAACGGCTACTCCAGCGGCTCCGCCGTCTTCGGAGACGACGAGCTTCTCGATGGCCTGGCCAGC
CCGTCGGACGGCCACTCGGCCATGCACGCCCATGGTCAGGACTATGCTGCCATCAGTGTCGGCTTCCCTCAGGGC
CCCTTCGCTTCGCATCGCGGCTCCGGCATGCACATCGACCCGTCGCAAATGAATGGTGCCTTTTCAAACACGCCC
GACGGCGACCCCATCCATAGCCCTTACGGCGCCAGCTTCAGCACCCACTTCCGCCAGATGCCAAACAGCCACTCC
TTCGGCACCTCCCTCCACTCGCCCATGTCCTACTCGGGCTCCCCGCTGGCTGGGGGGGATATCAACGCCGACGGC
CACGAGCCCGCCTATCTCAAGGCCAGGGCCCGCATGTCGCAGCAGATGCAGCGCAAGGCCTCCAACACCCGCAGC
CCCATGACGCCAAAGAATAATAGCATCCACGGCATCCCTATAGGGTCGCACGACTCTCCCGGCTACGGACCCCAG
CCCGTGCGAAACTCCGGCAGCCACGACAAGTCTCCCTCGGCTCAGTGGATGAATACGCCCGCAGGGAGCATACCC
GCCTCTTACAACTCGGGCTTCTCGTCCCCCATGCAGCAGGGCATGGTGCCCATCAACGAGGTGATGCTCAAGGGC
GGCACGTCGATGCCCGCCAAGCTGGGCGTCGCCTCGGGCGCCGTCTCGACGCAGGAGATGAAGCGGAAACGACGT
CGCGAGTCCCACAACCTCGTCGAGCGTCGCCGCCGCGACAACATCAACGAGAGGATTCAGGACCTGAGCAAGCTC
GTTCCCACCCACCGGCTGGAGGACGAAAAGATCCGCAAGCTGCTCAGCAATGGGACGCCCCTGTCGCCGACGCTG
ACGGGCATGTCGAACCCGTCGCAAGCCACGTCTGGCTTGGCCGGGCCTGGCGCTCGTCGGGCGGCTGGCGGCAGC
GCCGGCAATATCACGACGGGCCTCCCCATGGAGGAAAAGGACAAGGGTCCCAACAAGGGAGACATCCTCAACGGC
GCCGTCAGCTGGGCCCGCGATCTCATGTGGATGCTACACCTCAAGCTCCAACAGCAGGAGGAGCTGATGAACACC
ATCGCCGAGCTCGGAGGACACTTTCCATTTGAGCTGACCGAGGACGAGCGGCGCATGCAGACGGAGCTGATGGAC
GCCATGGCCAAGAGCGGGACCGGCTCCTTTTCCTACTCGAGGACGTCCGGTTCTGGCCTCCGGGTTCCCAGTCAC
ACGGACTATCGCGGAGACCCCGTCAACGGCTTGACGCCCAACCTGGACTCGATTGGCATCACGCCAGAGGACAAC
GGCAACGCGGGCCTGGGCGGAGACCTCGGAGACGCGGCGGCACAGTTCTGGCACGACCCCGACGATGACGGCAGC
GGAAATGCCTCGCTTCAGTTCAAGGAGGAAGACGAATATGACATGGACCTCACGCAGTAG
Transcript >Ophcf2|00149
ATGGCCCAACACGGCTTCAACCACTTCGGCTCCGCGCCCAACGGCGGAAACATCGATCCCAACGATCTCTCTATG
GCCGGTGACTACTCTCCGCCCTTCAACAATGGCGGAAGCAGCGCCGGTAACAATAACAATAACAACAACGGCACC
GGAAGCGCTCCTAACGGCTACTCCAGCGGCTCCGCCGTCTTCGGAGACGACGAGCTTCTCGATGGCCTGGCCAGC
CCGTCGGACGGCCACTCGGCCATGCACGCCCATGGTCAGGACTATGCTGCCATCAGTGTCGGCTTCCCTCAGGGC
CCCTTCGCTTCGCATCGCGGCTCCGGCATGCACATCGACCCGTCGCAAATGAATGGTGCCTTTTCAAACACGCCC
GACGGCGACCCCATCCATAGCCCTTACGGCGCCAGCTTCAGCACCCACTTCCGCCAGATGCCAAACAGCCACTCC
TTCGGCACCTCCCTCCACTCGCCCATGTCCTACTCGGGCTCCCCGCTGGCTGGGGGGGATATCAACGCCGACGGC
CACGAGCCCGCCTATCTCAAGGCCAGGGCCCGCATGTCGCAGCAGATGCAGCGCAAGGCCTCCAACACCCGCAGC
CCCATGACGCCAAAGAATAATAGCATCCACGGCATCCCTATAGGGTCGCACGACTCTCCCGGCTACGGACCCCAG
CCCGTGCGAAACTCCGGCAGCCACGACAAGTCTCCCTCGGCTCAGTGGATGAATACGCCCGCAGGGAGCATACCC
GCCTCTTACAACTCGGGCTTCTCGTCCCCCATGCAGCAGGGCATGGTGCCCATCAACGAGGTGATGCTCAAGGGC
GGCACGTCGATGCCCGCCAAGCTGGGCGTCGCCTCGGGCGCCGTCTCGACGCAGGAGATGAAGCGGAAACGACGT
CGCGAGTCCCACAACCTCGTCGAGCGTCGCCGCCGCGACAACATCAACGAGAGGATTCAGGACCTGAGCAAGCTC
GTTCCCACCCACCGGCTGGAGGACGAAAAGATCCGCAAGCTGCTCAGCAATGGGACGCCCCTGTCGCCGACGCTG
ACGGGCATGTCGAACCCGTCGCAAGCCACGTCTGGCTTGGCCGGGCCTGGCGCTCGTCGGGCGGCTGGCGGCAGC
GCCGGCAATATCACGACGGGCCTCCCCATGGAGGAAAAGGACAAGGGTCCCAACAAGGGAGACATCCTCAACGGC
GCCGTCAGCTGGGCCCGCGATCTCATGTGGATGCTACACCTCAAGCTCCAACAGCAGGAGGAGCTGATGAACACC
ATCGCCGAGCTCGGAGGACACTTTCCATTTGAGCTGACCGAGGACGAGCGGCGCATGCAGACGGAGCTGATGGAC
GCCATGGCCAAGAGCGGGACCGGCTCCTTTTCCTACTCGAGGACGTCCGGTTCTGGCCTCCGGGTTCCCAGTCAC
ACGGACTATCGCGGAGACCCCGTCAACGGCTTGACGCCCAACCTGGACTCGATTGGCATCACGCCAGAGGACAAC
GGCAACGCGGGCCTGGGCGGAGACCTCGGAGACGCGGCGGCACAGTTCTGGCACGACCCCGACGATGACGGCAGC
GGAAATGCCTCGCTTCAGTTCAAGGAGGAAGACGAATATGACATGGACCTCACGCAGTAG
Gene >Ophcf2|00149
ATGGCCCAACACGGCTTCAACCACTTCGGCTCCGCGCCCAACGGCGGAAACATCGATCCCAACGATCTCTCTATG
GCCGGTGACTACTCTCCGCCCTTCAACAATGGCGGAAGCAGCGCCGGTAACAATAACAATAACAACAACGGCACC
GGAAGCGCTCCTAACGGCTACTCCAGCGGCTCCGCCGTCTTCGGAGACGACGAGCTTCTCGATGGCCTGGCCAGC
CCGTCGGACGGCCACTCGGCCATGCACGCCCATGGTCAGGACTATGCTGCCATCAGTGTCGGCTTCCCTCAGGGC
CCCTTCGCTTCGCATCGCGGCTCCGGCATGCACATCGACCCGTCGCAAATGAATGGTGCCTTTTCAAACACGCCC
GACGGCGACCCCATCCATAGCCCTTACGGCGCCAGCTTCAGCACCCACTTCCGCCAGATGCCAAACAGCCACTCC
TTCGGCACCTCCCTCCACTCGCCCATGTCCTACTCGGGCTCCCCGCTGGCTGGGGGGGATATCAACGCCGACGGC
CACGAGCCCGCCTATCTCAAGGCCAGGGCCCGCATGTCGCAGCAGATGCAGCGCAAGGCCTCCAACACCCGCAGC
CCCATGACGCCAAAGAATAATAGCATCCACGGCATCCCTATAGGGTCGCACGACTCTCCCGGCTACGGACCCCAG
CCCGTGCGAAACTCCGGCAGCCACGACAAGTCTCCCTCGGCTCAGTGGATGAATACGCCCGCAGGGAGCATACCC
GCCTCTTACAACTCGGGCTTCTCGTCCCCCATGCAGCAGGGCATGGTGCCCATCAACGAGGTGATGCTCAAGGGC
GGCACGTCGATGCCCGCCAAGCTGGGCGTCGCCTCGGGCGCCGTCTCGACGCAGGAGATGAAGCGGAAACGACGT
CGCGAGTCCCACAACCTCGTCGAGCGTCGCCGCCGCGACAACATCAACGAGAGGATTCAGGACCTGAGCAAGCTC
GTTCCCACCCACCGGCTGGAGGACGAAAAGATCCGCAAGCTGCTCAGCAATGGGACGCCCCTGTCGCCGACGCTG
ACGGGCATGTCGAACCCGTCGCAAGCCACGTCTGGCTTGGCCGGGCCTGGCGCTCGTCGGGCGGCTGGCGGCAGC
GCCGGCAATATCACGACGGGCCTCCCCATGGAGGAAAAGGACAAGGGTCCCAACAAGGGAGACATCCTCAACGGC
GCCGTCAGCTGGGCCCGCGATCTCATGTGGATGCTACACCTCAAGCTCCAACAGCAGGAGGAGCTGATGAACACC
ATCGCCGAGCTCGGAGGACACTTTCCATTTGAGCTGACCGAGGACGAGCGGCGCATGCAGACGGAGCTGATGGAC
GCCATGGCCAAGAGCGGGACCGGCTCCTTTTCCTACTCGAGGACGTCCGGTTCTGGCCTCCGGGTTCCCAGTCAC
ACGGACTATCGCGGAGACCCCGTCAACGGCTTGACGCCCAACCTGGACTCGATTGGCATCACGCCAGAGGACAAC
GGCAACGCGGGCCTGGGCGGAGACCTCGGAGACGCGGCGGCACAGTTCTGGCACGACCCCGACGATGACGGCAGC
GGAAATGCCTCGCTTCAGTTCAAGGAGGAAGACGAATATGACATGGACCTCACGCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail