Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00145
Gene name
Locationscaffold_01:1005500..1007585
Strand+
Gene length (bp)2085
Transcript length (bp)1965
Coding sequence length (bp)1965
Protein length (aa) 655

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 6.0E-07 115 311
PF00083 Sugar_tr Sugar (and other) transporter 3.5E-16 364 551

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 148 170 22
2 185 207 22
3 257 279 22
4 294 314 20
5 350 369 19
6 392 414 22
7 426 443 17
8 490 512 22
9 519 536 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00145
MAPKEASSPDETEHHVIPGQVPGPPTDSDSDDYGLSPDERRIFSHVTRPDDCYTPEGIYWADLPWADRFAFVSRV
DLDADMQELRAFGSMAKKNPLSPLLWYFRNAVIPGAGLGLEGYVLFSIGNLEPLFRQVWPQCWEKHQVCGRNWVA
SVTYLEIIGIMVGQAAVGVIGDWIGRRWGLIQDALIMFVGLLMLTASWGFTLEGWVICYAWSLFFYSLGVGGEYP
ITATASLEGANGAGKLSTREDRLHRGRRVTMAFLMQGWGQFVNQVLLMVLLVIFNKGSGSPPYSSSAAQYTFRLS
FAFPAIGTAWLVYYRTWKMPHASKQLADAKSRSNVTGYDFHALRYCVNHFGGRLLATAGTWFCNDVFFYGNKLFQ
GHFIKVISHNPDSLMTSWYWSLVNIIISLAGYYSASLLIDNKLYGRRMMQQVGFFMCFLMFVIPAVQYDKYTKPE
HIHAFQAMYFISSFFNQFGPNSVTFLVAGEVFPTPIRATAHGFSACLGKSGALLASVLYNYIDTRVKFYVVTWFG
LVGMLLTWLFLPDTTGLDLKEQERRWNYIRQGRADDYHGVAVNPAHLSLWERMRGIGNTYDPELDWKAKIHDMRV
EWEAVQKARDPRESEDQDGHGMPEDGEFSQDIHDYFKRSATTSNTVVGEKTPSQ*
Coding >Ophcf2|00145
ATGGCGCCTAAGGAAGCGTCCTCGCCTGACGAGACGGAGCACCACGTTATTCCCGGTCAAGTTCCAGGCCCGCCC
ACCGACTCGGATAGCGACGACTATGGATTGAGCCCCGACGAGCGCCGCATCTTCAGCCACGTCACCCGTCCCGAC
GACTGCTACACCCCAGAGGGCATCTACTGGGCCGACCTGCCATGGGCCGACCGTTTCGCCTTTGTCTCGCGCGTC
GACCTCGATGCTGACATGCAAGAACTGCGCGCCTTCGGTTCCATGGCCAAGAAGAATCCCTTGTCGCCCTTGCTA
TGGTACTTTCGCAATGCTGTCATACCCGGCGCCGGCCTCGGCCTCGAGGGCTATGTCCTCTTCTCCATTGGCAAC
CTGGAACCTCTCTTTCGTCAAGTCTGGCCGCAATGCTGGGAGAAGCACCAGGTTTGCGGTCGGAACTGGGTGGCC
AGCGTCACCTACTTGGAAATCATCGGCATCATGGTTGGTCAGGCTGCCGTCGGTGTCATCGGTGATTGGATCGGC
CGTCGTTGGGGCCTGATCCAGGATGCCCTCATCATGTTCGTCGGTCTGCTCATGCTGACCGCTAGCTGGGGCTTC
ACGCTCGAGGGCTGGGTCATCTGCTATGCCTGGTCTCTGTTCTTCTACAGTCTTGGTGTAGGAGGCGAGTATCCC
ATCACCGCCACGGCGTCTCTCGAGGGCGCCAACGGTGCGGGAAAGCTGTCGACGCGAGAGGATCGCCTGCATCGC
GGACGCCGCGTCACCATGGCCTTTCTCATGCAAGGATGGGGCCAATTCGTCAACCAGGTTCTCCTCATGGTTCTC
CTCGTCATCTTCAATAAGGGCAGCGGCAGTCCGCCCTACAGCAGCTCGGCGGCCCAGTACACCTTTCGCTTGTCC
TTTGCCTTTCCCGCAATTGGCACCGCCTGGCTCGTCTACTACCGCACCTGGAAGATGCCTCACGCCTCCAAGCAG
CTCGCCGACGCCAAGAGTCGCTCCAACGTGACGGGCTACGACTTCCACGCCCTTCGCTACTGCGTCAACCACTTC
GGCGGCCGTCTCCTCGCCACTGCCGGCACCTGGTTCTGCAACGACGTCTTCTTCTACGGCAACAAACTCTTCCAG
GGCCACTTCATCAAAGTCATCTCGCACAACCCCGACTCCCTCATGACATCCTGGTACTGGAGCCTGGTCAACATC
ATCATCTCCTTGGCAGGCTACTACTCGGCTTCCCTCCTCATCGACAACAAGCTCTACGGGAGGAGGATGATGCAG
CAGGTCGGCTTCTTCATGTGCTTCCTCATGTTTGTCATTCCCGCCGTCCAATACGATAAGTACACCAAGCCCGAG
CACATACACGCCTTTCAGGCCATGTACTTCATCTCCTCCTTCTTCAATCAGTTCGGTCCAAACTCCGTCACCTTC
CTCGTCGCCGGTGAAGTCTTTCCCACGCCCATCCGCGCCACGGCTCACGGCTTCTCCGCCTGCCTCGGCAAGTCC
GGCGCTCTGCTCGCCTCGGTCCTCTACAATTACATCGACACCCGCGTCAAGTTCTACGTCGTCACCTGGTTCGGC
CTCGTCGGCATGCTGCTGACCTGGCTCTTTTTGCCGGACACGACGGGCCTGGATCTCAAGGAACAGGAGCGTCGA
TGGAACTACATCCGCCAAGGGAGGGCAGACGACTACCACGGCGTCGCCGTCAATCCCGCCCACCTCAGCCTGTGG
GAACGGATGCGAGGCATCGGCAACACGTACGACCCGGAGCTGGACTGGAAGGCCAAGATTCACGACATGCGCGTC
GAGTGGGAAGCTGTTCAGAAGGCCCGCGATCCAAGAGAGAGCGAGGACCAGGACGGACACGGCATGCCCGAGGAC
GGCGAATTTTCCCAAGACATTCACGACTATTTCAAGCGCTCGGCTACCACGTCCAATACCGTGGTTGGCGAGAAG
ACGCCGTCGCAATAA
Transcript >Ophcf2|00145
ATGGCGCCTAAGGAAGCGTCCTCGCCTGACGAGACGGAGCACCACGTTATTCCCGGTCAAGTTCCAGGCCCGCCC
ACCGACTCGGATAGCGACGACTATGGATTGAGCCCCGACGAGCGCCGCATCTTCAGCCACGTCACCCGTCCCGAC
GACTGCTACACCCCAGAGGGCATCTACTGGGCCGACCTGCCATGGGCCGACCGTTTCGCCTTTGTCTCGCGCGTC
GACCTCGATGCTGACATGCAAGAACTGCGCGCCTTCGGTTCCATGGCCAAGAAGAATCCCTTGTCGCCCTTGCTA
TGGTACTTTCGCAATGCTGTCATACCCGGCGCCGGCCTCGGCCTCGAGGGCTATGTCCTCTTCTCCATTGGCAAC
CTGGAACCTCTCTTTCGTCAAGTCTGGCCGCAATGCTGGGAGAAGCACCAGGTTTGCGGTCGGAACTGGGTGGCC
AGCGTCACCTACTTGGAAATCATCGGCATCATGGTTGGTCAGGCTGCCGTCGGTGTCATCGGTGATTGGATCGGC
CGTCGTTGGGGCCTGATCCAGGATGCCCTCATCATGTTCGTCGGTCTGCTCATGCTGACCGCTAGCTGGGGCTTC
ACGCTCGAGGGCTGGGTCATCTGCTATGCCTGGTCTCTGTTCTTCTACAGTCTTGGTGTAGGAGGCGAGTATCCC
ATCACCGCCACGGCGTCTCTCGAGGGCGCCAACGGTGCGGGAAAGCTGTCGACGCGAGAGGATCGCCTGCATCGC
GGACGCCGCGTCACCATGGCCTTTCTCATGCAAGGATGGGGCCAATTCGTCAACCAGGTTCTCCTCATGGTTCTC
CTCGTCATCTTCAATAAGGGCAGCGGCAGTCCGCCCTACAGCAGCTCGGCGGCCCAGTACACCTTTCGCTTGTCC
TTTGCCTTTCCCGCAATTGGCACCGCCTGGCTCGTCTACTACCGCACCTGGAAGATGCCTCACGCCTCCAAGCAG
CTCGCCGACGCCAAGAGTCGCTCCAACGTGACGGGCTACGACTTCCACGCCCTTCGCTACTGCGTCAACCACTTC
GGCGGCCGTCTCCTCGCCACTGCCGGCACCTGGTTCTGCAACGACGTCTTCTTCTACGGCAACAAACTCTTCCAG
GGCCACTTCATCAAAGTCATCTCGCACAACCCCGACTCCCTCATGACATCCTGGTACTGGAGCCTGGTCAACATC
ATCATCTCCTTGGCAGGCTACTACTCGGCTTCCCTCCTCATCGACAACAAGCTCTACGGGAGGAGGATGATGCAG
CAGGTCGGCTTCTTCATGTGCTTCCTCATGTTTGTCATTCCCGCCGTCCAATACGATAAGTACACCAAGCCCGAG
CACATACACGCCTTTCAGGCCATGTACTTCATCTCCTCCTTCTTCAATCAGTTCGGTCCAAACTCCGTCACCTTC
CTCGTCGCCGGTGAAGTCTTTCCCACGCCCATCCGCGCCACGGCTCACGGCTTCTCCGCCTGCCTCGGCAAGTCC
GGCGCTCTGCTCGCCTCGGTCCTCTACAATTACATCGACACCCGCGTCAAGTTCTACGTCGTCACCTGGTTCGGC
CTCGTCGGCATGCTGCTGACCTGGCTCTTTTTGCCGGACACGACGGGCCTGGATCTCAAGGAACAGGAGCGTCGA
TGGAACTACATCCGCCAAGGGAGGGCAGACGACTACCACGGCGTCGCCGTCAATCCCGCCCACCTCAGCCTGTGG
GAACGGATGCGAGGCATCGGCAACACGTACGACCCGGAGCTGGACTGGAAGGCCAAGATTCACGACATGCGCGTC
GAGTGGGAAGCTGTTCAGAAGGCCCGCGATCCAAGAGAGAGCGAGGACCAGGACGGACACGGCATGCCCGAGGAC
GGCGAATTTTCCCAAGACATTCACGACTATTTCAAGCGCTCGGCTACCACGTCCAATACCGTGGTTGGCGAGAAG
ACGCCGTCGCAATAA
Gene >Ophcf2|00145
ATGGCGCCTAAGGAAGCGTCCTCGCCTGACGAGACGGAGCACCACGTTATTCCCGGTCAAGTTCCAGGCCCGCCC
ACCGACTCGGATAGCGACGACTATGGATTGAGCCCCGACGAGCGCCGCATCTTCAGCCACGTCACCCGTCCCGAC
GACTGCTACACCCCAGAGGGCATCTACTGGGCCGACCTGCCATGGGCCGACCGTTTCGCCTTTGTCTCGCGCGTC
GACCTCGATGCTGACATGCAAGAACTGCGCGCCTTCGGTTCCATGGCCAAGAAGAATCCCTTGTCGCCCTTGCTA
TGGTACTTTCGCAATGCTGTCATACCCGGCGCCGGCCTCGGCCTCGAGGGCTATGTCCTCTTCTCCATTGGCAAC
CTGGAACCTCTCTTTCGTCAAGTCTGGCCGCAATGCTGGGAGAAGCACCAGGTTTGCGGTCGGAACTGGGTGGCC
AGCGTCACCTACTTGGAAATCATCGGCATCATGGTTGGTCAGGCTGCCGTCGGTGTAGGTTCCCCAACACTGGCT
CTTCACTAGCCTTTCTTTACCCAACTGACGATCTCGTCCCAGGTCATCGGTGATTGGATCGGCCGTCGTTGGGGC
CTGATCCAGGATGCCCTCATCATGTTCGTCGGTCTGCTCATGCTGACCGCTAGCTGGGGCTTCACGCTCGAGGGC
TGGGTCATCTGCTATGCCTGGTCTCTGTTCTTCTACAGTACGTCTCTCACATCCCTAACCAATGGCCTTTGCACC
TAACGACTTCCCCTGCTAGGTCTTGGTGTAGGAGGCGAGTATCCCATCACCGCCACGGCGTCTCTCGAGGGCGCC
AACGGTGCGGGAAAGCTGTCGACGCGAGAGGATCGCCTGCATCGCGGACGCCGCGTCACCATGGCCTTTCTCATG
CAAGGATGGGGCCAATTCGTCAACCAGGTTCTCCTCATGGTTCTCCTCGTCATCTTCAATAAGGGCAGCGGCAGT
CCGCCCTACAGCAGCTCGGCGGCCCAGTACACCTTTCGCTTGTCCTTTGCCTTTCCCGCAATTGGCACCGCCTGG
CTCGTCTACTACCGCACCTGGAAGATGCCTCACGCCTCCAAGCAGCTCGCCGACGCCAAGAGTCGCTCCAACGTG
ACGGGCTACGACTTCCACGCCCTTCGCTACTGCGTCAACCACTTCGGCGGCCGTCTCCTCGCCACTGCCGGCACC
TGGTTCTGCAACGACGTCTTCTTCTACGGCAACAAACTCTTCCAGGGCCACTTCATCAAAGTCATCTCGCACAAC
CCCGACTCCCTCATGACATCCTGGTACTGGAGCCTGGTCAACATCATCATCTCCTTGGCAGGCTACTACTCGGCT
TCCCTCCTCATCGACAACAAGCTCTACGGGAGGAGGATGATGCAGCAGGTCGGCTTCTTCATGTGCTTCCTCATG
TTTGTCATTCCCGCCGTCCAATACGATAAGTACACCAAGCCCGAGCACATACACGCCTTTCAGGCCATGTACTTC
ATCTCCTCCTTCTTCAATCAGTTCGGTCCAAACTCCGTCACCTTCCTCGTCGCCGGTGAAGTCTTTCCCACGCCC
ATCCGCGCCACGGCTCACGGCTTCTCCGCCTGCCTCGGCAAGTCCGGCGCTCTGCTCGCCTCGGTCCTCTACAAT
TACATCGACACCCGCGTCAAGTTCTACGTCGTCACCTGGTTCGGCCTCGTCGGCATGCTGCTGACCTGGCTCTTT
TTGCCGGACACGACGGGCCTGGATCTCAAGGAACAGGAGCGTCGATGGAACTACATCCGCCAAGGGAGGGCAGAC
GACTACCACGGCGTCGCCGTCAATCCCGCCCACCTCAGCCTGTGGGAACGGATGCGAGGCATCGGCAACACGTAC
GACCCGGAGCTGGACTGGAAGGCCAAGATTCACGACATGCGCGTCGAGTGGGAAGCTGTTCAGAAGGCCCGCGAT
CCAAGAGAGAGCGAGGACCAGGACGGACACGGCATGCCCGAGGACGGCGAATTTTCCCAAGACATTCACGACTAT
TTCAAGCGCTCGGCTACCACGTCCAATACCGTGGTTGGCGAGAAGACGCCGTCGCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail