Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00138
Gene name
Locationscaffold_01:975355..977736
Strand+
Gene length (bp)2381
Transcript length (bp)2247
Coding sequence length (bp)2247
Protein length (aa) 749

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14604 SH3_9 Variant SH3 domain 1.6E-10 599 646
PF14604 SH3_9 Variant SH3 domain 1.3E-14 697 745
PF00018 SH3_1 SH3 domain 8.3E-10 598 642
PF00018 SH3_1 SH3 domain 2.3E-13 697 741
PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein 6.2E-17 57 150
PF07653 SH3_2 Variant SH3 domain 6.4E-05 698 746

GO

GO Term Description Terminal node
GO:0003779 actin binding Yes
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0008092 cytoskeletal protein binding No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.66 0.1122 0.0829 0.3117 0.065 0.0069 0.0679 0.1468 0.3531 0.0089

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1559
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5670
Ophiocordyceps australis map64 (Brazil) OphauB2|2405
Ophiocordyceps camponoti-floridani Ophcf2|00138 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3542
Ophiocordyceps kimflemingae Ophio5|3799
Ophiocordyceps subramaniannii Hirsu2|1139

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00138
MASLNLSTSGPSIKSSYNGVVNGPPLSSPSPTHAQWALFSVQAPLVSAFQDGGAKESVLKVESTGVGELADLIED
FNEGRIQYAFVKVKDQNTALPKCVLIAWCGGGVPERTKGYFTSHTAAVAKVLHGYHVQITARSDSDLEPETIMKK
VSDASGAKYSNSGIGGVSSSAPSPAKSKPVFTPTASSSGRVVDPIVAARSRRDDSVDADGWGADAPPVTRTAIEK
VEPAYRPTKVNMAELTKQKPESSRADGAGRDDDASEDVVRGGYQPVGKVDIAAIRAAASNKNDDRPVPVKGAYEP
VGKVDIAAIRAKAQKPSDASLDDEASPSRPLPDRTAAFSQSGQSERMTSMPKPRVSNKFGGGPSFTGTKAPAPGG
LGYGSSSPSAPAPVTTTSRTFADQGGKTPAQIWAEKKARERGNSDAGAGGASATSPLGPQSTGAGEWKSGYKGKT
WAPVQAPGYSRGAADSDGQQNSGEAEEEPMRSPGGISALRDRFKDAPPMRSPTAQEAEPAPPVPKTSRPSQGYAL
PGLPNRLTPSAAADGGEEEEEVSSPIRVAAPVGRGAGTAEESPKRADNQAHAPQEEAHQPAHGGGSGRRALIQYD
YEKAEDNEIDLVDGEYVTNIDMVDEDWWMGTNSAGESGLFPSNYVELVEDGDAGEAEAAPSAPAPAPAPAPAPAP
APAPAPAPAPAAAEAGAPTATAMYDYEAAEDNELSFPEDAKITNLEFPDEDWWFGHYNGQSGLFPANYVELDS*
Coding >Ophcf2|00138
ATGGCCTCGCTGAATCTGTCGACCAGCGGGCCGTCGATAAAAAGCAGCTACAACGGCGTCGTCAATGGCCCTCCT
CTGTCGTCGCCCTCTCCCACCCACGCCCAGTGGGCGCTCTTCTCCGTTCAAGCACCGCTCGTCAGCGCCTTTCAA
GACGGCGGCGCCAAGGAAAGCGTCCTCAAGGTAGAGAGCACAGGTGTCGGCGAGCTTGCCGACCTGATCGAGGAC
TTCAACGAGGGCCGCATACAGTACGCCTTCGTCAAGGTCAAGGACCAGAATACGGCGCTCCCCAAGTGTGTCCTC
ATCGCCTGGTGTGGAGGCGGTGTTCCCGAGCGGACCAAAGGCTACTTCACCAGTCATACAGCCGCCGTCGCAAAA
GTCCTTCACGGCTATCACGTCCAAATCACCGCCCGCTCCGACAGTGATCTTGAGCCCGAGACGATCATGAAAAAG
GTATCCGATGCTTCCGGAGCCAAGTACTCGAACTCGGGCATCGGCGGCGTGTCTTCGTCGGCGCCGTCTCCTGCC
AAGTCCAAGCCCGTCTTCACGCCGACCGCCTCGAGTTCGGGGCGTGTCGTCGATCCCATTGTCGCCGCCCGGTCC
AGGAGGGACGACAGTGTCGACGCCGATGGCTGGGGTGCCGACGCTCCTCCCGTCACGAGAACCGCCATCGAAAAA
GTCGAGCCTGCGTATCGACCAACAAAGGTCAACATGGCCGAGCTCACGAAACAGAAGCCTGAATCTTCTCGTGCT
GACGGCGCCGGCCGTGATGATGATGCGTCCGAAGATGTCGTCAGAGGCGGCTACCAGCCTGTCGGCAAGGTAGAT
ATAGCCGCCATCCGAGCGGCGGCGAGCAATAAAAACGACGATCGACCGGTGCCGGTCAAGGGGGCCTACGAGCCT
GTCGGCAAGGTCGACATTGCGGCGATCCGCGCAAAGGCCCAGAAGCCCAGCGATGCATCGCTGGACGACGAGGCG
TCACCATCTCGACCGCTCCCTGACAGAACGGCCGCGTTTTCCCAGTCGGGCCAGTCGGAGCGCATGACGTCGATG
CCCAAGCCCAGGGTTTCCAACAAGTTCGGAGGCGGTCCTAGTTTCACCGGAACAAAGGCGCCGGCCCCGGGCGGA
CTCGGCTACGGGTCCTCGAGCCCCTCTGCTCCGGCTCCCGTGACGACGACGAGCCGAACCTTTGCGGACCAAGGG
GGCAAGACGCCAGCCCAGATCTGGGCGGAGAAGAAGGCGAGGGAAAGGGGCAATTCGGATGCCGGTGCCGGAGGC
GCATCTGCTACATCACCTTTGGGCCCCCAGTCGACCGGCGCCGGCGAGTGGAAGAGCGGTTATAAGGGCAAGACT
TGGGCTCCCGTCCAAGCACCCGGTTACAGCCGTGGCGCGGCCGATTCGGATGGCCAGCAGAACTCGGGAGAGGCA
GAGGAAGAGCCCATGCGTTCGCCAGGAGGCATCTCGGCTCTGCGCGATCGGTTCAAAGATGCGCCGCCCATGCGC
TCACCTACCGCTCAGGAGGCCGAGCCTGCGCCGCCGGTGCCCAAAACCTCGAGACCCTCCCAGGGCTACGCGCTT
CCTGGTCTGCCCAACCGCCTCACACCTTCTGCCGCCGCCGACGGTGGGGAAGAGGAAGAAGAGGTTTCGTCTCCG
ATCCGGGTAGCTGCCCCTGTGGGACGCGGCGCAGGCACAGCGGAAGAAAGCCCTAAGCGAGCGGATAATCAAGCT
CACGCACCTCAAGAGGAAGCGCACCAGCCGGCGCACGGCGGCGGAAGCGGCAGACGAGCCCTTATCCAATACGAC
TACGAAAAGGCTGAGGACAACGAGATTGACCTCGTCGACGGCGAATACGTCACCAACATTGACATGGTCGACGAG
GACTGGTGGATGGGCACCAATTCGGCTGGCGAGAGCGGCCTATTCCCGAGCAACTACGTGGAACTCGTCGAAGAC
GGCGACGCGGGCGAAGCCGAAGCCGCCCCCTCTGCACCGGCACCGGCACCGGCACCGGCACCCGCTCCGGCACCC
GCTCCGGCACCCGCACCCGCTCCGGCGCCGGCCGCGGCGGAGGCGGGCGCTCCGACGGCCACAGCTATGTATGAC
TATGAGGCGGCCGAGGACAACGAGCTCAGCTTCCCCGAAGACGCAAAGATAACGAATCTCGAATTCCCGGACGAG
GATTGGTGGTTTGGTCACTACAACGGGCAGTCGGGCCTCTTTCCTGCCAACTACGTCGAGCTGGATTCGTAG
Transcript >Ophcf2|00138
ATGGCCTCGCTGAATCTGTCGACCAGCGGGCCGTCGATAAAAAGCAGCTACAACGGCGTCGTCAATGGCCCTCCT
CTGTCGTCGCCCTCTCCCACCCACGCCCAGTGGGCGCTCTTCTCCGTTCAAGCACCGCTCGTCAGCGCCTTTCAA
GACGGCGGCGCCAAGGAAAGCGTCCTCAAGGTAGAGAGCACAGGTGTCGGCGAGCTTGCCGACCTGATCGAGGAC
TTCAACGAGGGCCGCATACAGTACGCCTTCGTCAAGGTCAAGGACCAGAATACGGCGCTCCCCAAGTGTGTCCTC
ATCGCCTGGTGTGGAGGCGGTGTTCCCGAGCGGACCAAAGGCTACTTCACCAGTCATACAGCCGCCGTCGCAAAA
GTCCTTCACGGCTATCACGTCCAAATCACCGCCCGCTCCGACAGTGATCTTGAGCCCGAGACGATCATGAAAAAG
GTATCCGATGCTTCCGGAGCCAAGTACTCGAACTCGGGCATCGGCGGCGTGTCTTCGTCGGCGCCGTCTCCTGCC
AAGTCCAAGCCCGTCTTCACGCCGACCGCCTCGAGTTCGGGGCGTGTCGTCGATCCCATTGTCGCCGCCCGGTCC
AGGAGGGACGACAGTGTCGACGCCGATGGCTGGGGTGCCGACGCTCCTCCCGTCACGAGAACCGCCATCGAAAAA
GTCGAGCCTGCGTATCGACCAACAAAGGTCAACATGGCCGAGCTCACGAAACAGAAGCCTGAATCTTCTCGTGCT
GACGGCGCCGGCCGTGATGATGATGCGTCCGAAGATGTCGTCAGAGGCGGCTACCAGCCTGTCGGCAAGGTAGAT
ATAGCCGCCATCCGAGCGGCGGCGAGCAATAAAAACGACGATCGACCGGTGCCGGTCAAGGGGGCCTACGAGCCT
GTCGGCAAGGTCGACATTGCGGCGATCCGCGCAAAGGCCCAGAAGCCCAGCGATGCATCGCTGGACGACGAGGCG
TCACCATCTCGACCGCTCCCTGACAGAACGGCCGCGTTTTCCCAGTCGGGCCAGTCGGAGCGCATGACGTCGATG
CCCAAGCCCAGGGTTTCCAACAAGTTCGGAGGCGGTCCTAGTTTCACCGGAACAAAGGCGCCGGCCCCGGGCGGA
CTCGGCTACGGGTCCTCGAGCCCCTCTGCTCCGGCTCCCGTGACGACGACGAGCCGAACCTTTGCGGACCAAGGG
GGCAAGACGCCAGCCCAGATCTGGGCGGAGAAGAAGGCGAGGGAAAGGGGCAATTCGGATGCCGGTGCCGGAGGC
GCATCTGCTACATCACCTTTGGGCCCCCAGTCGACCGGCGCCGGCGAGTGGAAGAGCGGTTATAAGGGCAAGACT
TGGGCTCCCGTCCAAGCACCCGGTTACAGCCGTGGCGCGGCCGATTCGGATGGCCAGCAGAACTCGGGAGAGGCA
GAGGAAGAGCCCATGCGTTCGCCAGGAGGCATCTCGGCTCTGCGCGATCGGTTCAAAGATGCGCCGCCCATGCGC
TCACCTACCGCTCAGGAGGCCGAGCCTGCGCCGCCGGTGCCCAAAACCTCGAGACCCTCCCAGGGCTACGCGCTT
CCTGGTCTGCCCAACCGCCTCACACCTTCTGCCGCCGCCGACGGTGGGGAAGAGGAAGAAGAGGTTTCGTCTCCG
ATCCGGGTAGCTGCCCCTGTGGGACGCGGCGCAGGCACAGCGGAAGAAAGCCCTAAGCGAGCGGATAATCAAGCT
CACGCACCTCAAGAGGAAGCGCACCAGCCGGCGCACGGCGGCGGAAGCGGCAGACGAGCCCTTATCCAATACGAC
TACGAAAAGGCTGAGGACAACGAGATTGACCTCGTCGACGGCGAATACGTCACCAACATTGACATGGTCGACGAG
GACTGGTGGATGGGCACCAATTCGGCTGGCGAGAGCGGCCTATTCCCGAGCAACTACGTGGAACTCGTCGAAGAC
GGCGACGCGGGCGAAGCCGAAGCCGCCCCCTCTGCACCGGCACCGGCACCGGCACCGGCACCCGCTCCGGCACCC
GCTCCGGCACCCGCACCCGCTCCGGCGCCGGCCGCGGCGGAGGCGGGCGCTCCGACGGCCACAGCTATGTATGAC
TATGAGGCGGCCGAGGACAACGAGCTCAGCTTCCCCGAAGACGCAAAGATAACGAATCTCGAATTCCCGGACGAG
GATTGGTGGTTTGGTCACTACAACGGGCAGTCGGGCCTCTTTCCTGCCAACTACGTCGAGCTGGATTCGTAG
Gene >Ophcf2|00138
ATGGCCTCGCTGAATCTGTCGACCAGCGGGCCGTCGATAAAAAGCAGCTACAACGGCGTCGTCAATGGCCCTCCT
CTGTCGTCGCCCTCTCCCACCCACGCCCAGTGGGCGCTCTTCTCCGTTCAAGCACCGCTCGTCAGCGCCTTTCAA
GACGGCGGCGCCAAGGAAAGCGTCCTCAAGGTAGAGAGCACAGGTGGTACGAAGCTCTGCCCGCTCTCATGCGCC
CTTGGCCTCCCTTTTCGCTAATCTGTGCTGCAGTCGGCGAGCTTGCCGACCTGATCGAGGACTTCAACGAGGGCC
GCATACAGTACGCCTTCGTCAAGGTCAAGGACCAGAATACGGCGCTCCCCAAGTGTGTCCTCATCGCCTGGTGTG
GAGGCGGTGTTCCCGAGCGGACCAAAGGCTACTTCACCAGTCATACAGCCGCCGTCGCAAAAGTCCTTCACGGCT
ATCACGTCCAAATCACCGCCCGCTCCGACAGTGATCTTGAGCCCGAGACGATCATGAAAAAGGTATCCGATGCTT
CCGGAGCCAAGTACTCGAACTCGGGCATCGGCGGCGTGTCTTCGTCGGCGCCGTCTCCTGCCAAGTCCAAGCCCG
TCTTCACGCCGACCGCCTCGAGTTCGGGGCGTGTCGTCGATCCCATTGTCGCCGCCCGGTCCAGGAGGGACGACA
GTGTCGACGCCGATGGCTGGGGTGCCGACGCTCCTCCCGTCACGAGAACCGCCATCGAAAAAGTCGAGCCTGCGT
ATCGACCAACAAAGGTCAACATGGCCGAGCTCACGAAACAGAAGCCTGAATCTTCTCGTGCTGACGGCGCCGGCC
GTGATGATGATGCGTCCGAAGATGTCGTCAGAGGCGGCTACCAGCCTGTCGGCAAGGTAGATATAGCCGCCATCC
GAGCGGCGGCGAGCAATAAAAACGACGATCGACCGGTGCCGGTCAAGGGGGCCTACGAGCCTGTCGGCAAGGTCG
ACATTGCGGCGATCCGCGCAAAGGCCCAGAAGCCCAGCGATGCATCGCTGGACGACGAGGCGTCACCATCTCGAC
CGCTCCCTGACAGAACGGCCGCGTTTTCCCAGTCGGGCCAGTCGGAGCGCATGACGTCGATGCCCAAGCCCAGGG
TTTCCAACAAGTTCGGAGGCGGTCCTAGTTTCACCGGAACAAAGGCGCCGGCCCCGGGCGGACTCGGCTACGGGT
CCTCGAGCCCCTCTGCTCCGGCTCCCGTGACGACGACGAGCCGAACCTTTGCGGACCAAGGGGGCAAGACGCCAG
CCCAGATCTGGGCGGAGAAGAAGGCGAGGGAAAGGGGCAATTCGGATGCCGGTGCCGGAGGCGCATCTGCTACAT
CACCTTTGGGCCCCCAGTCGACCGGCGCCGGCGAGTGGAAGAGCGGTTATAAGGGCAAGACTTGGGCTCCCGTCC
AAGCACCCGGTTACAGCCGTGGCGCGGCCGATTCGGATGGCCAGCAGAACTCGGGAGAGGCAGAGGAAGAGCCCA
TGCGTTCGCCAGGAGGCATCTCGGCTCTGCGCGATCGGTTCAAAGATGCGCCGCCCATGCGCTCACCTACCGCTC
AGGAGGCCGAGCCTGCGCCGCCGGTGCCCAAAACCTCGAGACCCTCCCAGGGCTACGCGCTTCCTGGTCTGCCCA
ACCGCCTCACACCTTCTGCCGCCGCCGACGGTGGGGAAGAGGAAGAAGAGGTTTCGTCTCCGATCCGGGTAGCTG
CCCCTGTGGGACGCGGCGCAGGCACAGCGGAAGAAAGCCCTAAGCGAGCGGATAATCAAGCTCACGCACCTCAAG
AGGAAGCGCACCAGCCGGCGCACGGCGGCGGAAGCGGCAGACGAGCCCTTATCCAATACGACTACGAAAAGGCTG
AGGACAACGAGATTGACCTCGTCGACGGCGAATACGTCACCAACATTGACATGGTCGACGAGGACTGGTGGATGG
GCACCAATTCGGCTGGCGAGAGCGGCCTATTCCCGAGCAACTACGTGGAACTCGTCGAAGACGGCGACGCGGGCG
AAGCCGAAGCCGCCCCCTCTGCACCGGCACCGGCACCGGCACCGGCACCCGCTCCGGCACCCGCTCCGGCACCCG
CACCCGCTCCGGCGCCGGCCGCGGCGGAGGCGGGCGCTCCGACGGCCACAGCTATGTATGACTATGAGGCGGCCG
AGGACAACGGTGAGTGCTCAACGAGCCCTTGAAGGCTACCCAGGTACGGACGAGATGACTGACTTTAAGACGCCG
TTGTAGAGCTCAGCTTCCCCGAAGACGCAAAGATAACGAATCTCGAATTCCCGGACGAGGATTGGTGGTTTGGTC
ACTACAACGGGCAGTCGGGCCTCTTTCCTGCCAACTACGTCGAGCTGGATTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail