Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00137
Gene name
Locationscaffold_01:973884..974724
Strand-
Gene length (bp)840
Transcript length (bp)783
Coding sequence length (bp)783
Protein length (aa) 261

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00462 Glutaredoxin Glutaredoxin 2.9E-18 165 229
PF00085 Thioredoxin Thioredoxin 6.6E-11 8 102

GO

GO Term Description Terminal node
GO:0097573 glutathione oxidoreductase activity Yes
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0003674 molecular_function No
GO:0015035 protein-disulfide reductase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0015036 disulfide oxidoreductase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.691 0.488 0.0049 0.2371 0.3873 0.0087 0.1848 0.2028 0.1195 0.0474

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1558
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5669
Ophiocordyceps australis map64 (Brazil) OphauB2|2404
Ophiocordyceps camponoti-floridani Ophcf2|00137 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1942
Ophiocordyceps kimflemingae Ophio5|3800
Ophiocordyceps subramaniannii Hirsu2|1138

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00137
MSTITEITSSSQWDELLDSAPPSALLVVSFHAPWAAPCAQMAKVLSTLASEFPVSQPPTTLWASINAEDLSEISE
TYDVTAVPFLVLLRGGRVVETVSGSSAVKVRTAIETHSRAGDKPPSQIGVTNGLLDPSAQKADSQPSADPEKQKQ
DLNKRLKDLVNAAPVMLFMKGTPSSPQCGFSRQIVAILREKSVKYGFFNILADDEVRQGLKEYAEWPTYPQLWID
GELVGGLDIVKEELANDQDFLKPYCAGTIPESAAA*
Coding >Ophcf2|00137
ATGTCGACCATCACGGAGATCACGTCCTCGTCGCAGTGGGATGAGCTGCTGGACTCGGCGCCCCCCTCAGCGCTC
CTCGTCGTCTCCTTTCACGCTCCGTGGGCCGCTCCGTGCGCCCAGATGGCCAAGGTTCTCTCGACCTTGGCCTCT
GAATTTCCCGTCAGCCAACCGCCTACGACGCTGTGGGCTTCCATCAACGCCGAGGATCTCAGCGAGATCAGCGAG
ACCTATGACGTCACCGCAGTCCCTTTCCTGGTGCTGCTGAGGGGCGGCCGCGTCGTCGAGACGGTCAGCGGCAGT
AGCGCCGTCAAGGTCAGGACGGCCATCGAGACTCACTCGCGCGCTGGCGATAAGCCACCGTCCCAGATTGGTGTC
ACCAACGGGCTTCTGGATCCCAGTGCCCAGAAGGCCGACAGTCAGCCATCTGCGGACCCGGAAAAGCAGAAGCAG
GATCTCAACAAGCGCCTCAAGGATCTCGTCAACGCCGCGCCTGTCATGCTCTTTATGAAGGGCACTCCGAGTTCA
CCCCAATGCGGCTTCTCGAGACAGATTGTGGCGATCCTGCGTGAAAAGTCTGTCAAGTACGGATTTTTCAACATT
CTTGCCGACGACGAGGTTCGACAGGGCCTAAAGGAGTATGCCGAATGGCCGACGTATCCGCAGCTATGGATCGAT
GGCGAACTCGTCGGTGGACTCGATATAGTAAAAGAAGAGCTCGCGAACGACCAGGACTTTCTGAAACCATATTGC
GCCGGCACCATCCCGGAATCAGCAGCGGCGTGA
Transcript >Ophcf2|00137
ATGTCGACCATCACGGAGATCACGTCCTCGTCGCAGTGGGATGAGCTGCTGGACTCGGCGCCCCCCTCAGCGCTC
CTCGTCGTCTCCTTTCACGCTCCGTGGGCCGCTCCGTGCGCCCAGATGGCCAAGGTTCTCTCGACCTTGGCCTCT
GAATTTCCCGTCAGCCAACCGCCTACGACGCTGTGGGCTTCCATCAACGCCGAGGATCTCAGCGAGATCAGCGAG
ACCTATGACGTCACCGCAGTCCCTTTCCTGGTGCTGCTGAGGGGCGGCCGCGTCGTCGAGACGGTCAGCGGCAGT
AGCGCCGTCAAGGTCAGGACGGCCATCGAGACTCACTCGCGCGCTGGCGATAAGCCACCGTCCCAGATTGGTGTC
ACCAACGGGCTTCTGGATCCCAGTGCCCAGAAGGCCGACAGTCAGCCATCTGCGGACCCGGAAAAGCAGAAGCAG
GATCTCAACAAGCGCCTCAAGGATCTCGTCAACGCCGCGCCTGTCATGCTCTTTATGAAGGGCACTCCGAGTTCA
CCCCAATGCGGCTTCTCGAGACAGATTGTGGCGATCCTGCGTGAAAAGTCTGTCAAGTACGGATTTTTCAACATT
CTTGCCGACGACGAGGTTCGACAGGGCCTAAAGGAGTATGCCGAATGGCCGACGTATCCGCAGCTATGGATCGAT
GGCGAACTCGTCGGTGGACTCGATATAGTAAAAGAAGAGCTCGCGAACGACCAGGACTTTCTGAAACCATATTGC
GCCGGCACCATCCCGGAATCAGCAGCGGCGTGA
Gene >Ophcf2|00137
ATGTCGACCATCACGGAGATCACGTCCTCGTCGCAGTGGGATGAGCTGCTGGACTCGGCGCCCCCCTCAGCGCTC
CTCGTCGTCTCCTTTCACGCTCCGTGGGCCGCTCCGTGCGCCCAGATGGCCAAGGTTCTCTCGACCTTGGCCTCT
GAATTTCCCGTCAGCCAACCGCCTACGACGCTGTGGGCTTCCATCAACGCCGAGGATCTCAGCGAGATCAGCGAG
ACCTATGACGTCACCGCAGTCCCTTTCCTGGTGCTGCTGAGGGGCGGCCGCGTCGTCGAGACGGTCAGCGGCAGT
AGCGCCGTCAAGGTCAGGACGGCCATCGAGACTCACTCGCGCGCTGGCGATAAGCCACCGTCCCAGATTGGTGTC
ACCAACGGGCTTCTGGATCCCAGTGCCCAGAAGGCCGACAGTCAGCCATCTGCGGACCCGGAAAAGCAGAAGCAG
GATCTCAACAAGCGCCTCAAGGATCTCGTCAACGCCGCGCCTGTCATGCTCTTTATGAAGGGCACTCCGAGTTCA
CCCCAATGCGGCTTCTCGAGACAGATTGTGGCGATCCTGCGTGAAAAGTCTGTCAAGTACGGATTTTTCAACATT
CTTGCCGACGACGAGGTTCGACAGGGCCTAAAGGAGTATGCCGAATGGCCGACGTATCCGCAGCTATGGATCGAT
GGCGAACTCGTCGGTGGACTCGATATAGTGAGCTGTCTTTGGCCTTCGCGAGTCCCTGATGAGTCGACTAACGCT
CATCACCAGGTAAAAGAAGAGCTCGCGAACGACCAGGACTTTCTGAAACCATATTGCGCCGGCACCATCCCGGAA
TCAGCAGCGGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail