Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00131
Gene name
Locationscaffold_01:955965..956359
Strand+
Gene length (bp)394
Transcript length (bp)306
Coding sequence length (bp)306
Protein length (aa) 102

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like 3.8E-20 23 88
PF00240 ubiquitin Ubiquitin family 5.4E-10 22 92

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.5779 0.4963 0.0915 0.1972 0.1833 0.0034 0.1761 0.2696 0.2518 0.0225

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4890
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4037
Ophiocordyceps australis map64 (Brazil) OphauB2|526
Ophiocordyceps camponoti-floridani Ophcf2|00131 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2959
Ophiocordyceps kimflemingae Ophio5|3808
Ophiocordyceps subramaniannii Hirsu2|1132

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00131
MSAEGSPDRHEPEPPVNSEHLNIKVTDNNNEVFFKIKRSTKLEKLMNAFCERQGKSVTSVRFLFDGTRVQPTDTP
DTLEMADGDSLEVHQEQVGGGPLLGL*
Coding >Ophcf2|00131
ATGTCTGCGGAAGGATCGCCTGATCGCCATGAGCCCGAACCGCCGGTCAACAGCGAACACCTTAACATAAAAGTC
ACGGACAACAACAACGAAGTCTTCTTTAAGATAAAGAGGAGTACGAAACTCGAGAAGCTGATGAATGCATTCTGT
GAACGTCAAGGCAAGAGCGTCACCTCGGTGCGTTTCCTTTTCGATGGCACCCGTGTCCAGCCGACGGACACGCCA
GATACCCTCGAGATGGCCGATGGGGACTCGCTCGAGGTGCACCAGGAGCAGGTCGGTGGTGGCCCTTTGCTTGGG
CTATGA
Transcript >Ophcf2|00131
ATGTCTGCGGAAGGATCGCCTGATCGCCATGAGCCCGAACCGCCGGTCAACAGCGAACACCTTAACATAAAAGTC
ACGGACAACAACAACGAAGTCTTCTTTAAGATAAAGAGGAGTACGAAACTCGAGAAGCTGATGAATGCATTCTGT
GAACGTCAAGGCAAGAGCGTCACCTCGGTGCGTTTCCTTTTCGATGGCACCCGTGTCCAGCCGACGGACACGCCA
GATACCCTCGAGATGGCCGATGGGGACTCGCTCGAGGTGCACCAGGAGCAGGTCGGTGGTGGCCCTTTGCTTGGG
CTATGA
Gene >Ophcf2|00131
ATGTCTGCGGAAGGATCGCCTGATCGCCATGAGCCCGAACCGCCGGTCAACAGCGAACACCTTAACATAAAAGTC
ACGGACAACAACAACGAAGTCTTCTTTAAGATAAAGAGGAGTACGAAACTCGAGAAGCTGATGAATGCATTCTGT
GAACGTCAAGGCAAGAGCGTCACCTCGGTGCGTTTCCTTTTCGATGGCACCCGTGTCCAGCCGACGGACACGCCA
GATACCGTACGTTTTCCCCCTATCCCCCCCCCCCCCTCCCCCTCTCGGCACGCTTTCACCTTGGGAAGCCTACGC
TGACGGGTGCTGCTTACAGCTCGAGATGGCCGATGGGGACTCGCTCGAGGTGCACCAGGAGCAGGTCGGTGGTGG
CCCTTTGCTTGGGCTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail