Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00130
Gene name
Locationscaffold_01:954745..955156
Strand-
Gene length (bp)411
Transcript length (bp)243
Coding sequence length (bp)243
Protein length (aa) 81

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08991 MTCP1 Mature-T-Cell Proliferation I type 3.7E-29 12 73

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Peroxisomal targeting signal 0.3127 0.1382 0.4606 0.1007 0.5779 0.1215 0.2668 0.0844 0.0744 0.5166

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4889
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4038
Ophiocordyceps australis map64 (Brazil) OphauB2|527
Ophiocordyceps camponoti-floridani Ophcf2|00130 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2960
Ophiocordyceps kimflemingae Ophio5|3809
Ophiocordyceps subramaniannii Hirsu2|1131

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00130
MTKTDDVEATPPCHPRACAIQDCLSRNNYNEAKCREFVRALYKCCRRFYDRYGEEAQTPSCPQPDLLRLKLEQQG
SAEQR*
Coding >Ophcf2|00130
ATGACGAAGACAGACGATGTAGAGGCTACTCCTCCCTGCCATCCGCGCGCCTGCGCTATCCAAGATTGCCTGAGC
CGCAACAACTACAACGAGGCCAAGTGCCGCGAGTTCGTGAGAGCCCTGTACAAATGCTGCCGGCGCTTCTACGAC
CGCTACGGCGAAGAAGCTCAGACGCCGAGTTGTCCCCAGCCGGACCTGCTGCGGCTGAAGCTCGAGCAGCAGGGG
AGCGCTGAGCAACGATAG
Transcript >Ophcf2|00130
ATGACGAAGACAGACGATGTAGAGGCTACTCCTCCCTGCCATCCGCGCGCCTGCGCTATCCAAGATTGCCTGAGC
CGCAACAACTACAACGAGGCCAAGTGCCGCGAGTTCGTGAGAGCCCTGTACAAATGCTGCCGGCGCTTCTACGAC
CGCTACGGCGAAGAAGCTCAGACGCCGAGTTGTCCCCAGCCGGACCTGCTGCGGCTGAAGCTCGAGCAGCAGGGG
AGCGCTGAGCAACGATAG
Gene >Ophcf2|00130
ATGGTCCGTCGCCGCGGATCCTCCTCTACTACTCCGCCGTGGCTGACGGCGATGGCAGACGAAGACAGACGATGT
AGAGGCTACTCCTCCCTGCCATCCGCGCGCCGTGCGTCCTGCCTCCCTGCTACTAAGGCTCAGAACGTGTCGTCT
AACGTGAACCAACCAGTGCGCTATCCAAGGTGCGATGACCCCGTGACTCCACGGCCTCCGTTCCGCGCTCACGCC
GGCGCAGATTGCCTGAGCCGCAACAACTACAACGAGGCCAAGTGCCGCGAGTTCGTGAGAGCCCTGTACAAATGC
TGCCGGCGCTTCTACGACCGCTACGGCGAAGAAGCTCAGACGCCGAGTTGTCCCCAGCCGGACCTGCTGCGGCTG
AAGCTCGAGCAGCAGGGGAGCGCTGAGCAACGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail