Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00129
Gene name
Locationscaffold_01:951233..954184
Strand-
Gene length (bp)2951
Transcript length (bp)2817
Coding sequence length (bp)2817
Protein length (aa) 939

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04121 Nup84_Nup100 Nuclear pore protein 84 / 107 4.8E-170 106 904

GO

GO Term Description Terminal node
GO:0017056 structural constituent of nuclear pore Yes
GO:0005643 nuclear pore Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0005198 structural molecule activity No
GO:0032991 protein-containing complex No
GO:0140513 nuclear protein-containing complex No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2446 0.8891 0.2267 0.0202 0.0249 0.0014 0.0529 0.0234 0.0952 0.0067

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1555
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4039
Ophiocordyceps australis map64 (Brazil) OphauB2|528
Ophiocordyceps camponoti-floridani Ophcf2|00129 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2961
Ophiocordyceps kimflemingae Ophio5|3811
Ophiocordyceps subramaniannii Hirsu2|1130

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00129
MDSEKEPKEATDGKEATSKRADKPREKITPSPLVEAFANALDGCLVPVVSAAEKRARILDLPRKFHESAIRRLMQ
KRPKRSHDDVDMDADDMETSQADSRKQEKIKLLEKEVQTWDLVRRLLPLRHSEAQTPTSLFDAAVRPLQASSLDI
FVKADPVIKERRAVLQWLQTSAASGPDIDELARDLQQNADRGDIIAYGWLHTRSRIKLRKSVTAWPHLLDKQSPG
VAASHTSSDGSPLVTHLDPDAATRQDCKLEPQDEFFERAIWLGCFEHLRRGSSLQTIQEWCRERTEMWRAISMSG
LLLTADGEERLTETPPASLVLWRRMCLSLARIGGTKDHERAVYGLLSGDISSVERVAKSWDDHLFAHFNALVRSQ
IDTFLLGLCPPELVSQLAKEFPSMDAMQFHVGLSSVEKRLITTLESQPDIRQEALEPHKALQASLIAKDLENHLY
EQARVLMDDAKEDGKSWLQPSGFLWPRAKDESVRDKVFRLKQHDGLRIVSHVCVLVALVRQQDQKEGGSIFHGLS
RSDEALETIIAAYTDLLERANLKELIPLYCSVLQPPRRYEVLGWNMIKEKDAARRMSQLKMMSKVGINVLEFVEM
LPRLVFEQIETAGGGDAIVAEKLFRIVVAGQTDYRIERVISPGFFAEFQVEVSMTDEQIIRSLEWLLLVEAAWPE
VLRIGVKAYKLFYGDMKLLAARRLMERVQFAAILQALSDEDMDAALSDDVDFWVRHLEQSGITSAKPEQVMTDAR
DYRDLENLAKALDSLEDVGNRMKCLPRLLKRGDSKEKDESNDLMASTGENVWRQLGHDVKVMRERMDPLLKGWLL
ASIEAGDSELRKLRQRFLPEATLAMVTGLQVAGMGYSRDMLLESMDLATAIAESDSDLAKSLMEAGRMRELVNAF
AACSRSLATIKGDKRASVSSSKKLREKGWSRDLWQVTI*
Coding >Ophcf2|00129
ATGGATTCGGAAAAGGAGCCCAAGGAGGCGACAGATGGCAAAGAGGCAACCAGCAAAAGGGCTGATAAACCAAGG
GAAAAAATCACGCCCAGTCCGCTCGTCGAGGCCTTTGCCAACGCCCTCGATGGCTGTCTTGTCCCCGTCGTGAGC
GCGGCCGAGAAGCGAGCTCGGATCCTGGATCTCCCCCGGAAATTCCACGAGAGTGCGATCCGACGACTGATGCAG
AAGCGGCCCAAACGCTCACACGATGACGTTGATATGGACGCGGATGATATGGAAACCTCCCAAGCAGACTCGAGG
AAGCAGGAAAAGATCAAGCTATTGGAGAAAGAGGTGCAAACATGGGATCTCGTCCGTCGCCTCCTCCCCCTTCGA
CACTCCGAGGCGCAGACGCCCACCTCGCTCTTCGATGCGGCAGTAAGGCCCTTGCAGGCTAGCTCCCTCGACATC
TTCGTCAAGGCCGATCCTGTCATCAAGGAGCGACGCGCCGTTCTCCAGTGGCTGCAGACGTCAGCGGCCTCTGGT
CCCGACATCGACGAGCTGGCGCGTGACCTGCAGCAAAATGCCGATAGGGGAGATATCATCGCCTACGGCTGGCTT
CACACCCGCTCCCGGATCAAGCTCAGGAAAAGCGTCACCGCCTGGCCGCACCTGTTGGACAAGCAGTCTCCCGGC
GTGGCGGCCTCCCACACCAGCTCCGACGGCTCGCCTCTCGTCACCCACTTGGATCCGGACGCGGCCACCCGACAA
GATTGCAAACTCGAGCCTCAGGACGAGTTCTTCGAGCGCGCCATCTGGCTGGGCTGCTTTGAGCATCTACGCCGC
GGCAGCAGTCTACAGACCATCCAAGAGTGGTGCCGCGAACGCACCGAGATGTGGAGGGCCATTTCTATGTCGGGG
CTGCTGCTAACCGCTGACGGCGAGGAGCGCCTGACCGAGACGCCGCCGGCGTCCCTGGTCTTATGGCGACGCATG
TGCCTGAGCCTGGCTCGGATCGGCGGCACCAAAGATCATGAACGAGCCGTATACGGGCTGTTATCGGGAGACATC
TCCAGCGTCGAGCGGGTGGCCAAGAGCTGGGACGACCATCTCTTTGCCCACTTCAACGCTCTCGTTCGGAGCCAG
ATCGACACTTTTCTGTTGGGACTATGCCCACCTGAGCTGGTGTCCCAGTTGGCCAAGGAATTTCCATCCATGGAC
GCCATGCAGTTTCATGTCGGATTGAGCAGTGTCGAGAAGCGGCTGATAACGACGCTCGAGTCTCAACCTGACATC
CGACAGGAGGCCCTGGAGCCTCACAAGGCTCTTCAGGCCTCCCTGATAGCGAAAGATCTGGAGAATCACTTGTAC
GAGCAGGCGCGGGTGCTGATGGACGACGCGAAGGAAGACGGCAAGTCTTGGCTTCAACCGTCGGGCTTCCTCTGG
CCACGCGCCAAAGACGAATCTGTCCGCGACAAAGTCTTTCGGCTGAAGCAGCATGACGGCCTCCGTATCGTGAGC
CACGTGTGCGTGCTCGTCGCCCTCGTGCGCCAGCAGGATCAGAAGGAGGGCGGATCCATCTTCCATGGCTTATCG
CGCTCCGACGAGGCCTTGGAGACCATAATTGCCGCCTACACGGACCTCTTGGAGCGGGCCAACCTTAAGGAGCTG
ATACCTCTGTACTGCTCCGTCCTGCAGCCTCCTCGGCGATACGAGGTGCTCGGCTGGAACATGATCAAGGAGAAG
GATGCCGCACGGCGCATGTCGCAGCTGAAGATGATGAGCAAGGTCGGAATCAACGTGCTCGAATTTGTCGAGATG
TTGCCGAGGCTGGTCTTTGAGCAGATTGAGACAGCCGGCGGCGGTGATGCCATCGTGGCTGAGAAGCTCTTCAGG
ATCGTCGTTGCAGGACAAACGGATTACAGAATCGAACGAGTCATCAGTCCCGGCTTCTTCGCCGAATTCCAAGTC
GAGGTGTCGATGACGGATGAGCAAATCATCCGGTCACTCGAGTGGCTACTGCTGGTGGAGGCTGCATGGCCCGAG
GTGTTGCGCATCGGAGTGAAGGCGTACAAGCTCTTCTACGGGGACATGAAATTGCTGGCGGCGCGGAGGCTCATG
GAACGTGTCCAGTTTGCTGCCATCTTGCAGGCGCTCAGCGACGAGGACATGGATGCCGCACTATCCGATGACGTC
GACTTTTGGGTGCGGCATCTCGAGCAGAGCGGAATCACGAGCGCAAAACCGGAGCAGGTCATGACCGACGCCCGA
GACTATCGTGACCTGGAGAACCTGGCCAAAGCACTCGACAGCCTAGAAGACGTGGGTAATCGGATGAAGTGCTTG
CCACGGTTATTGAAAAGGGGCGACTCAAAAGAAAAGGACGAGAGTAACGACTTGATGGCTTCGACGGGAGAGAAT
GTGTGGAGGCAGCTGGGACACGATGTCAAGGTGATGAGAGAGAGGATGGACCCGCTGCTGAAAGGCTGGCTGCTG
GCGAGCATCGAAGCGGGCGACTCGGAGCTCCGCAAGCTGCGACAGAGATTCTTGCCCGAGGCGACGCTAGCCATG
GTGACGGGCCTGCAAGTAGCGGGCATGGGCTACAGCCGCGACATGCTGCTGGAAAGCATGGACCTCGCGACGGCC
ATCGCCGAATCGGACTCAGATCTGGCCAAGTCGTTGATGGAGGCGGGTCGGATGAGGGAGCTGGTGAATGCCTTT
GCAGCGTGCAGCAGGTCTCTGGCCACCATCAAGGGCGACAAGCGGGCGTCGGTCTCGAGCAGCAAGAAGCTGCGA
GAGAAAGGGTGGTCTCGCGATCTCTGGCAGGTCACCATATGA
Transcript >Ophcf2|00129
ATGGATTCGGAAAAGGAGCCCAAGGAGGCGACAGATGGCAAAGAGGCAACCAGCAAAAGGGCTGATAAACCAAGG
GAAAAAATCACGCCCAGTCCGCTCGTCGAGGCCTTTGCCAACGCCCTCGATGGCTGTCTTGTCCCCGTCGTGAGC
GCGGCCGAGAAGCGAGCTCGGATCCTGGATCTCCCCCGGAAATTCCACGAGAGTGCGATCCGACGACTGATGCAG
AAGCGGCCCAAACGCTCACACGATGACGTTGATATGGACGCGGATGATATGGAAACCTCCCAAGCAGACTCGAGG
AAGCAGGAAAAGATCAAGCTATTGGAGAAAGAGGTGCAAACATGGGATCTCGTCCGTCGCCTCCTCCCCCTTCGA
CACTCCGAGGCGCAGACGCCCACCTCGCTCTTCGATGCGGCAGTAAGGCCCTTGCAGGCTAGCTCCCTCGACATC
TTCGTCAAGGCCGATCCTGTCATCAAGGAGCGACGCGCCGTTCTCCAGTGGCTGCAGACGTCAGCGGCCTCTGGT
CCCGACATCGACGAGCTGGCGCGTGACCTGCAGCAAAATGCCGATAGGGGAGATATCATCGCCTACGGCTGGCTT
CACACCCGCTCCCGGATCAAGCTCAGGAAAAGCGTCACCGCCTGGCCGCACCTGTTGGACAAGCAGTCTCCCGGC
GTGGCGGCCTCCCACACCAGCTCCGACGGCTCGCCTCTCGTCACCCACTTGGATCCGGACGCGGCCACCCGACAA
GATTGCAAACTCGAGCCTCAGGACGAGTTCTTCGAGCGCGCCATCTGGCTGGGCTGCTTTGAGCATCTACGCCGC
GGCAGCAGTCTACAGACCATCCAAGAGTGGTGCCGCGAACGCACCGAGATGTGGAGGGCCATTTCTATGTCGGGG
CTGCTGCTAACCGCTGACGGCGAGGAGCGCCTGACCGAGACGCCGCCGGCGTCCCTGGTCTTATGGCGACGCATG
TGCCTGAGCCTGGCTCGGATCGGCGGCACCAAAGATCATGAACGAGCCGTATACGGGCTGTTATCGGGAGACATC
TCCAGCGTCGAGCGGGTGGCCAAGAGCTGGGACGACCATCTCTTTGCCCACTTCAACGCTCTCGTTCGGAGCCAG
ATCGACACTTTTCTGTTGGGACTATGCCCACCTGAGCTGGTGTCCCAGTTGGCCAAGGAATTTCCATCCATGGAC
GCCATGCAGTTTCATGTCGGATTGAGCAGTGTCGAGAAGCGGCTGATAACGACGCTCGAGTCTCAACCTGACATC
CGACAGGAGGCCCTGGAGCCTCACAAGGCTCTTCAGGCCTCCCTGATAGCGAAAGATCTGGAGAATCACTTGTAC
GAGCAGGCGCGGGTGCTGATGGACGACGCGAAGGAAGACGGCAAGTCTTGGCTTCAACCGTCGGGCTTCCTCTGG
CCACGCGCCAAAGACGAATCTGTCCGCGACAAAGTCTTTCGGCTGAAGCAGCATGACGGCCTCCGTATCGTGAGC
CACGTGTGCGTGCTCGTCGCCCTCGTGCGCCAGCAGGATCAGAAGGAGGGCGGATCCATCTTCCATGGCTTATCG
CGCTCCGACGAGGCCTTGGAGACCATAATTGCCGCCTACACGGACCTCTTGGAGCGGGCCAACCTTAAGGAGCTG
ATACCTCTGTACTGCTCCGTCCTGCAGCCTCCTCGGCGATACGAGGTGCTCGGCTGGAACATGATCAAGGAGAAG
GATGCCGCACGGCGCATGTCGCAGCTGAAGATGATGAGCAAGGTCGGAATCAACGTGCTCGAATTTGTCGAGATG
TTGCCGAGGCTGGTCTTTGAGCAGATTGAGACAGCCGGCGGCGGTGATGCCATCGTGGCTGAGAAGCTCTTCAGG
ATCGTCGTTGCAGGACAAACGGATTACAGAATCGAACGAGTCATCAGTCCCGGCTTCTTCGCCGAATTCCAAGTC
GAGGTGTCGATGACGGATGAGCAAATCATCCGGTCACTCGAGTGGCTACTGCTGGTGGAGGCTGCATGGCCCGAG
GTGTTGCGCATCGGAGTGAAGGCGTACAAGCTCTTCTACGGGGACATGAAATTGCTGGCGGCGCGGAGGCTCATG
GAACGTGTCCAGTTTGCTGCCATCTTGCAGGCGCTCAGCGACGAGGACATGGATGCCGCACTATCCGATGACGTC
GACTTTTGGGTGCGGCATCTCGAGCAGAGCGGAATCACGAGCGCAAAACCGGAGCAGGTCATGACCGACGCCCGA
GACTATCGTGACCTGGAGAACCTGGCCAAAGCACTCGACAGCCTAGAAGACGTGGGTAATCGGATGAAGTGCTTG
CCACGGTTATTGAAAAGGGGCGACTCAAAAGAAAAGGACGAGAGTAACGACTTGATGGCTTCGACGGGAGAGAAT
GTGTGGAGGCAGCTGGGACACGATGTCAAGGTGATGAGAGAGAGGATGGACCCGCTGCTGAAAGGCTGGCTGCTG
GCGAGCATCGAAGCGGGCGACTCGGAGCTCCGCAAGCTGCGACAGAGATTCTTGCCCGAGGCGACGCTAGCCATG
GTGACGGGCCTGCAAGTAGCGGGCATGGGCTACAGCCGCGACATGCTGCTGGAAAGCATGGACCTCGCGACGGCC
ATCGCCGAATCGGACTCAGATCTGGCCAAGTCGTTGATGGAGGCGGGTCGGATGAGGGAGCTGGTGAATGCCTTT
GCAGCGTGCAGCAGGTCTCTGGCCACCATCAAGGGCGACAAGCGGGCGTCGGTCTCGAGCAGCAAGAAGCTGCGA
GAGAAAGGGTGGTCTCGCGATCTCTGGCAGGTCACCATATGA
Gene >Ophcf2|00129
ATGGATTCGGAAAAGGAGCCCAAGGAGGCGACAGATGGCAAAGAGGCAACCAGCAAAAGGGCTGATAAACCAAGG
GAAAAAATCACGCCCAGTCCGCTCGTCGAGGCCTTTGCCAACGCCCTCGATGGCTGTCTTGTCCCCGTCGTGAGC
GCGGCCGAGAAGCGAGCTCGGATCCTGGATCTCCCCCGGAAATTCCACGAGAGTGCGATCCGACGACTGATGCAG
AAGCGGCCCAAACGCTCACACGATGACGTTGATATGGACGCGGATGATATGGAAACCTCCCAAGCAGACTCGAGG
AAGCAGGAAAAGATCAAGCTATTGGAGAAAGAGGTGCAAACATGGGATCTCGTCCGTCGCCTCCTCCCCCTTCGA
CACTCCGAGGCGCAGACGCCCACCTCGCTCTTCGATGCGGCAGTAAGGCCCTTGCAGGCTAGCTCCCTCGACATC
TTCGTCAAGGCCGATCCTGTCATCAAGGAGCGACGCGCCGTTCTCCAGTGGCTGCAGACGTCAGCGGCCTCTGGT
CCCGACATCGACGAGCTGGCGCGTGACCTGCAGCAAAATGCCGATAGGGGAGATATCATCGCCTACGGCTGGCTT
CACACCCGCTCCCGGATCAAGCTCAGGAAAAGCGTCACCGCCTGGCCGCACCTGTTGGACAAGCAGTCTCCCGGC
GTGGCGGCCTCCCACACCAGCTCCGACGGCTCGCCTCTCGTCACCCACTTGGATCCGGACGCGGCCACCCGACAA
GATTGCAAACTCGAGCCTCAGGACGAGTTCTTCGAGCGCGCCATCTGGCTGGGCTGCTTTGAGCATCTACGCCGC
GGCAGCAGTCTACAGACCATCCAAGAGTGGTGCCGCGAACGCACCGAGATGTGGAGGGCCATTTCTATGTCGGGG
CTGCTGCTAACCGCTGACGGCGAGGAGCGCCTGACCGAGACGCCGCCGGCGTCCCTGGTCTTATGGCGACGCATG
TGCCTGAGCCTGGCTCGGATCGGCGGCACCAAAGATCATGAACGAGCCGTATACGGGCTGTTATCGGGAGACATC
TCCAGCGTCGAGCGGGTGGCCAAGAGCTGGGACGACCATCTCTTTGCCCACTTCAACGCTCTCGTTCGGAGCCAG
ATCGACACTTTTCTGTTGGGACTATGCCCACCTGAGCTGGTGTCCCAGTTGGCCAAGGAATTTCCATCCATGGAC
GCCATGCAGTTTCATGTCGGATTGAGCAGTGTCGAGAAGCGGCTGATAACGACGCTCGAGTCTCAACCTGACATC
CGACAGGAGGCCCTGGAGCCTCACAAGGCTCTTCAGGCCTCCCTGATAGCGAAAGATCTGGAGAATCACTTGTAC
GAGCAGGCGCGGGTGCTGATGGACGACGCGAAGGAAGACGGCAAGTCTTGGCTTCAACCGTCGGGCTTCCTCTGG
CCACGCGCCAAAGACGAATCTGTCCGCGACAAAGTCTTTCGGCTGAAGCAGCATGACGGCCTCCGTATCGTGAGC
CACGTGTGCGTGCTCGTCGCCCTCGTGCGCCAGCAGGATCAGAAGGAGGGCGGATCCATCTTCCATGGCTTATCG
CGCTCCGACGAGGCCTTGGAGACCATAATTGCCGCCTACACGGACCTCTTGGAGCGGGCCAACCTTAAGGAGCTG
ATACCTCTGTACTGCTCCGTCCTGCAGCCTCCTCGGCGATACGAGGTGCTCGGCTGGAACATGATCAAGGAGAAG
GATGCCGCACGGCGCATGTCGCAGCTGAAGATGATGAGCAAGGTCGGAATCAACGTGCTCGAATTTGTCGAGATG
TTGCCGAGGCTGGTCTTTGAGCAGATTGAGACAGCCGGCGGCGGTGATGCCATCGTGGCTGAGAAGCTCTTCAGG
ATCGTCGTTGCAGGACAAACGGATTACAGAATCGAACGAGTCATCAGTCCCGGCTTCTTCGCCGAATTCCAAGTC
GAGGTGTCGATGACGGATGAGCAAATCATCCGGTCACTCGAGTGGCTACTGCTGGTGGAGGCTGCATGGCCCGAG
GTGTTGCGCATCGGAGTGAAGGCGTACAAGCTCTTCTACGGTGAGTCGCGACAGAACCAGCGAGCGGCTTCGGAC
TGACAGCAGGACAGGGGACATGAAATTGCTGGCGGCGCGGAGGCTCATGGAACGTGTCCAGTTTGCTGCCATCTT
GCAGGCGCTCAGCGACGAGGACATGGATGCCGCACTATCCGATGACGTCGACTTTTGGGTGCGGCATCTCGAGCA
GAGCGGAATCACGAGCGCAAAACCGGAGCAGGTCATGACCGACGCCCGAGACTATCGTGACCTGGAGAACCTGGC
CAAAGCACTCGACAGCCTAGAAGACGTGGGTAATCGGATGAAGTGCTTGCCACGGTTATTGAAAAGGGGCGACTC
AAAAGAAAAGGACGAGAGTAACGACTTGATGGCTTCGACGGGAGAGAATGTGTGGAGGCAGCTGGGACACGATGT
CAAGGTGATGAGAGAGAGGATGGACCCGCTGCTGAAAGGCTGGCTGCTGGCGAGCATCGAAGGTATGTTTCCAAG
ATGGCTCAGAAGCAAAAAGGGACGAAGAAGAAGAAGAAGAGGAAGAAGAGCTGGCTAACAGGGAGATTTCAGCGG
GCGACTCGGAGCTCCGCAAGCTGCGACAGAGATTCTTGCCCGAGGCGACGCTAGCCATGGTGACGGGCCTGCAAG
TAGCGGGCATGGGCTACAGCCGCGACATGCTGCTGGAAAGCATGGACCTCGCGACGGCCATCGCCGAATCGGACT
CAGATCTGGCCAAGTCGTTGATGGAGGCGGGTCGGATGAGGGAGCTGGTGAATGCCTTTGCAGCGTGCAGCAGGT
CTCTGGCCACCATCAAGGGCGACAAGCGGGCGTCGGTCTCGAGCAGCAAGAAGCTGCGAGAGAAAGGGTGGTCTC
GCGATCTCTGGCAGGTCACCATATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail