Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00128
Gene name
Locationscaffold_01:950170..951005
Strand-
Gene length (bp)835
Transcript length (bp)729
Coding sequence length (bp)729
Protein length (aa) 243

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07200 Mod_r Modifier of rudimentary (Mod(r)) protein 4.0E-28 73 229

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6597 0.6091 0.0314 0.0365 0.1551 0.0014 0.091 0.3385 0.1528 0.0423

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5366
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4040
Ophiocordyceps australis map64 (Brazil) OphauB2|529
Ophiocordyceps camponoti-floridani Ophcf2|00128 (this protein)
Ophiocordyceps kimflemingae Ophio5|3812
Ophiocordyceps subramaniannii Hirsu2|5326

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00128
MAGLPPDAGVVAGSTPPAPPPKAGSHDTSRMGTPAPLAPADDSLGDGAAAKPFPQSDIGPDPGPGWLPALLRDKS
AQQLAELLSSPRLLEALTHAPQAAHATLIATHVDLSQALSQNAQLASQLSTQATRLSRQRSSTQAQLLATHGLER
QWRQKQSDMDLALAPFSPASLYQRLVQGIHEQAAVCNALEESFLDAEAEANGPASEREVADWVRRYREAKVQLYL
RQERKERWDEGRVGGWR*
Coding >Ophcf2|00128
ATGGCCGGTCTACCTCCAGATGCAGGCGTCGTCGCCGGCTCGACGCCTCCCGCGCCGCCCCCGAAAGCCGGAAGC
CACGACACCAGCCGGATGGGCACGCCCGCGCCTCTCGCCCCAGCCGACGACAGCCTCGGCGACGGAGCGGCGGCG
AAGCCCTTTCCGCAGTCGGACATTGGGCCCGATCCGGGTCCTGGATGGCTCCCGGCACTGCTGCGGGATAAGTCG
GCCCAACAGCTCGCAGAGCTCCTCAGCTCCCCTCGCCTCCTCGAAGCACTCACACACGCCCCCCAAGCCGCACAC
GCGACCCTCATAGCTACCCACGTCGACCTCTCCCAAGCCCTCTCGCAAAACGCCCAGCTAGCAAGCCAGCTCTCG
ACGCAGGCAACGCGCCTCTCGCGCCAGCGGTCGTCGACGCAGGCGCAGCTGCTGGCCACGCACGGGCTCGAACGG
CAATGGCGTCAGAAGCAGTCGGACATGGACCTCGCCCTCGCGCCCTTCTCCCCGGCTTCGCTCTATCAGCGCCTC
GTACAGGGTATCCACGAGCAGGCTGCCGTCTGCAACGCCCTCGAAGAGAGCTTCCTCGACGCCGAAGCCGAGGCT
AACGGTCCCGCCTCGGAACGTGAGGTGGCTGACTGGGTTCGCAGGTACAGGGAGGCCAAGGTTCAGCTCTATCTG
CGGCAGGAACGCAAGGAGCGTTGGGACGAGGGTCGCGTTGGTGGATGGAGGTAA
Transcript >Ophcf2|00128
ATGGCCGGTCTACCTCCAGATGCAGGCGTCGTCGCCGGCTCGACGCCTCCCGCGCCGCCCCCGAAAGCCGGAAGC
CACGACACCAGCCGGATGGGCACGCCCGCGCCTCTCGCCCCAGCCGACGACAGCCTCGGCGACGGAGCGGCGGCG
AAGCCCTTTCCGCAGTCGGACATTGGGCCCGATCCGGGTCCTGGATGGCTCCCGGCACTGCTGCGGGATAAGTCG
GCCCAACAGCTCGCAGAGCTCCTCAGCTCCCCTCGCCTCCTCGAAGCACTCACACACGCCCCCCAAGCCGCACAC
GCGACCCTCATAGCTACCCACGTCGACCTCTCCCAAGCCCTCTCGCAAAACGCCCAGCTAGCAAGCCAGCTCTCG
ACGCAGGCAACGCGCCTCTCGCGCCAGCGGTCGTCGACGCAGGCGCAGCTGCTGGCCACGCACGGGCTCGAACGG
CAATGGCGTCAGAAGCAGTCGGACATGGACCTCGCCCTCGCGCCCTTCTCCCCGGCTTCGCTCTATCAGCGCCTC
GTACAGGGTATCCACGAGCAGGCTGCCGTCTGCAACGCCCTCGAAGAGAGCTTCCTCGACGCCGAAGCCGAGGCT
AACGGTCCCGCCTCGGAACGTGAGGTGGCTGACTGGGTTCGCAGGTACAGGGAGGCCAAGGTTCAGCTCTATCTG
CGGCAGGAACGCAAGGAGCGTTGGGACGAGGGTCGCGTTGGTGGATGGAGGTAA
Gene >Ophcf2|00128
ATGGCCGGTCTACCTCCAGATGCAGGCGTCGTCGCCGGCTCGACGCCTCCCGCGCCGCCCCCGAAAGCCGGAAGC
CACGACACCAGCCGGATGGGCACGCCCGCGCCTCTCGCCCCAGCCGACGACAGCCTCGGCGACGGAGCGGCGGCG
AAGCCCTTTCCGCAGTCGGACATTGGGCCCGATCCGGGTCCTGGATGGCTCCCGGCACTGCTGCGGGATAAGTCG
TGAGTCTGCCCTTTGAAAAAGGAGGAGAGGGAGAAGGAAATGGAAATGGAAATGGAGAAGAAGAGAAAGAGAACA
AGAGACGAAAAAGAAGCTCCCGTCATCTAGGGCCCAACAGCTCGCAGAGCTCCTCAGCTCCCCTCGCCTCCTCGA
AGCACTCACACACGCCCCCCAAGCCGCACACGCGACCCTCATAGCTACCCACGTCGACCTCTCCCAAGCCCTCTC
GCAAAACGCCCAGCTAGCAAGCCAGCTCTCGACGCAGGCAACGCGCCTCTCGCGCCAGCGGTCGTCGACGCAGGC
GCAGCTGCTGGCCACGCACGGGCTCGAACGGCAATGGCGTCAGAAGCAGTCGGACATGGACCTCGCCCTCGCGCC
CTTCTCCCCGGCTTCGCTCTATCAGCGCCTCGTACAGGGTATCCACGAGCAGGCTGCCGTCTGCAACGCCCTCGA
AGAGAGCTTCCTCGACGCCGAAGCCGAGGCTAACGGTCCCGCCTCGGAACGTGAGGTGGCTGACTGGGTTCGCAG
GTACAGGGAGGCCAAGGTTCAGCTCTATCTGCGGCAGGAACGCAAGGAGCGTTGGGACGAGGGTCGCGTTGGTGG
ATGGAGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail