Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00115
Gene name
Locationscaffold_01:883461..884683
Strand-
Gene length (bp)1222
Transcript length (bp)726
Coding sequence length (bp)726
Protein length (aa) 242

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.9E-12 12 107
PF12796 Ank_2 Ankyrin repeats (3 copies) 7.2E-15 114 208
PF13857 Ank_5 Ankyrin repeats (many copies) 1.2E-09 96 152
PF13857 Ank_5 Ankyrin repeats (many copies) 1.2E-09 170 218
PF13637 Ank_4 Ankyrin repeats (many copies) 3.2E-08 88 130
PF13637 Ank_4 Ankyrin repeats (many copies) 4.8E-09 148 198
PF13606 Ank_3 Ankyrin repeat 3.0E-03 178 204
PF00023 Ank Ankyrin repeat 9.3E-04 76 108
PF00023 Ank Ankyrin repeat 8.4E-03 178 206

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.7269 0.5879 0.0613 0.0903 0.2416 0.0979 0.0847 0.1806 0.0951 0.0334

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup475
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6777
Ophiocordyceps australis map64 (Brazil) OphauB2|5577
Ophiocordyceps camponoti-floridani Ophcf2|00115 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2284
Ophiocordyceps camponoti-rufipedis Ophun1|2655
Ophiocordyceps kimflemingae Ophio5|3827
Ophiocordyceps subramaniannii Hirsu2|10473
Ophiocordyceps subramaniannii Hirsu2|7168

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00115
MDQDSVRDPFPLHTAARLGYVAKAEALLEADPKLSWRKDYDGRYPIHWAASSNTLDIVVLLAKQDSFDPDVQDDS
GWSPLMISASVPDSEPVLQILLQKGADVNEKNNSSQSALHFVASKKNLDVARLLLGAKPPASTRVRDNRGQYPIH
RAAAVGSVPMIRLLLQSDSPINAADVEGFTPLHHAIAEGHGDAAVVLLEKGADFTVKNGDGELALDLAPDKEIRR
FVLQGAEREGIDMSSS*
Coding >Ophcf2|00115
ATGGACCAAGACTCAGTACGAGATCCGTTCCCGCTGCACACCGCCGCACGCCTAGGCTACGTGGCCAAGGCGGAA
GCACTCCTAGAGGCGGACCCGAAGCTATCGTGGCGCAAAGACTACGATGGCAGGTACCCCATCCACTGGGCCGCC
TCATCCAACACCCTGGACATCGTCGTTCTGCTGGCCAAGCAAGACAGTTTCGACCCAGACGTTCAGGATGACAGT
GGCTGGTCGCCACTCATGATATCCGCCAGCGTCCCTGACAGCGAGCCCGTGCTCCAGATACTCCTGCAAAAGGGT
GCCGACGTGAATGAGAAAAACAATAGTAGTCAGTCGGCGCTACACTTCGTGGCCTCCAAGAAGAATCTCGACGTC
GCTCGCCTTCTACTCGGAGCCAAGCCCCCAGCATCGACGCGAGTACGCGATAATCGAGGGCAGTACCCCATACAT
CGCGCTGCTGCCGTCGGCTCCGTACCCATGATCCGCCTCCTTCTGCAGAGCGACAGTCCGATCAATGCGGCGGAC
GTCGAGGGGTTCACGCCGTTGCATCATGCCATCGCCGAAGGTCACGGGGACGCTGCCGTTGTGCTTCTTGAAAAG
GGTGCCGACTTCACCGTGAAGAACGGCGACGGTGAGCTGGCTCTTGACTTGGCGCCCGATAAGGAGATACGTCGT
TTTGTTCTACAAGGGGCCGAGAGAGAAGGCATCGACATGTCGTCGTCGTAG
Transcript >Ophcf2|00115
ATGGACCAAGACTCAGTACGAGATCCGTTCCCGCTGCACACCGCCGCACGCCTAGGCTACGTGGCCAAGGCGGAA
GCACTCCTAGAGGCGGACCCGAAGCTATCGTGGCGCAAAGACTACGATGGCAGGTACCCCATCCACTGGGCCGCC
TCATCCAACACCCTGGACATCGTCGTTCTGCTGGCCAAGCAAGACAGTTTCGACCCAGACGTTCAGGATGACAGT
GGCTGGTCGCCACTCATGATATCCGCCAGCGTCCCTGACAGCGAGCCCGTGCTCCAGATACTCCTGCAAAAGGGT
GCCGACGTGAATGAGAAAAACAATAGTAGTCAGTCGGCGCTACACTTCGTGGCCTCCAAGAAGAATCTCGACGTC
GCTCGCCTTCTACTCGGAGCCAAGCCCCCAGCATCGACGCGAGTACGCGATAATCGAGGGCAGTACCCCATACAT
CGCGCTGCTGCCGTCGGCTCCGTACCCATGATCCGCCTCCTTCTGCAGAGCGACAGTCCGATCAATGCGGCGGAC
GTCGAGGGGTTCACGCCGTTGCATCATGCCATCGCCGAAGGTCACGGGGACGCTGCCGTTGTGCTTCTTGAAAAG
GGTGCCGACTTCACCGTGAAGAACGGCGACGGTGAGCTGGCTCTTGACTTGGCGCCCGATAAGGAGATACGTCGT
TTTGTTCTACAAGGGGCCGAGAGAGAAGGCATCGACATGTCGTCGTCGTAG
Gene >Ophcf2|00115
ATGGACCAAGACTCAGTACGAGATCCGTTCCCGCTGCACACCGCCGCACGCCTAGGCTACGGTAAGACCACGGAG
AGACCAACTCAAAGAGCTTCCTCACAACATCTATCTACGCAGTGGCCAAGGCGGAAGCACTCCTAGAGGCACGTT
ACGCCCCCGCGTGACTCTCACAGGCCGTCGAGCGACCCTCGTCAGAATCCTCGTCCAATTTTAACAACCAGATAC
GAACAGGCGGACCCGAAGCTATCGTGGCGCAAAGACTACGATGGCAGGTACCCCATCCACTGGGCCGCCTCATCC
AACACCCTGGACATCGTCGTTCTGCTGGCCAAGCAAGACAGTTTCGACCCAGACGTTCAGGTGAGTACCTTAGCC
CGCATGCTCACCTCGTGCCATGGACAAGTACTGGGCAACTGTCTCACATCTCAAACTCCCGGCGCAGGATGACAG
TGGCTGGTCGCCACTCATGATATCCGCCAGCGTCCCTGACAGCGAGCCCGTGCTCCAGATACTCCTGCAAAAGGG
TGCCGACGTGAATGAGAAAAGTGACCAACCCCCCCCAACCCCCCCTATCTTCCGAAATATTCGGTCGTGACTGGA
GGAGCTGCTAATAACATCGACGCCTGCTCTACAGACAATAGTAGTCAGGTGAGGGAAATTTTCACTCACTTGGAG
CGCTGGAAAACTACTCACACAGGCCACTCGTCGCAGTCGGCGCTACACTTCGTGGCCTCCAAGAAGAATCTCGAC
GTCGCTCGCCTTCTACTCGGAGCCAAGCCCCCAGCATCGACGCGAGTACGCGATAATCGAGGGCAGTACCCCATA
CATCGCGCTGCTGCCGTCGGCTCCGTACCCATGATCCGCCTCCTTCTGCAGAGCGACAGTCCGATCAATGCGGCG
GACGTCGAGGGGTTCACGCCGTTGCATCATGCCATCGCCGAAGGTCACGGTATGGGAAATCATCTCCGCGAAGGC
GTCTTCTCGGCCCGCTGACGTGCCGAGCGACAGGGGACGCTGCCGTTGTGCTTCTTGAAAAGGGTGCCGACTTCA
CCGTGAAGAACGGCGACGGTGAGCTGGCTCTTGACTTGGCGCCCGATAAGGAGGCAAGTTGGCACCATACGAGCC
GTCGCGTGGTTGAGTCAATAATGCTGAGACCGCCTAGATACGTCGTTTTGTTCTACAAGGGGCCGAGAGAGAAGG
CATCGACATGTCGTCGTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail